KEGG   Corynebacterium glutamicum MB001: cgp_0766Help
Entry
cgp_0766          CDS       T02791                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase (ICD)
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cgm  Corynebacterium glutamicum MB001
Pathway
cgm00020  Citrate cycle (TCA cycle)
cgm00480  Glutathione metabolism
cgm01100  Metabolic pathways
cgm01110  Biosynthesis of secondary metabolites
cgm01120  Microbial metabolism in diverse environments
cgm01200  Carbon metabolism
cgm01210  2-Oxocarboxylic acid metabolism
cgm01230  Biosynthesis of amino acids
Module
cgm_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cgm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    cgp_0766 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    cgp_0766 (icd)
Enzymes [BR:cgm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     cgp_0766 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH Cadherin_pro
Motif
Other DBs
NCBI-ProteinID: AGT04658
Structure
PDB: 

Position
complement(680722..682938)
Genome map
AA seq 738 aa AA seqDB search
MAKIIWTRTDEAPLLATYSLKPVVEAFAATAGIEVETRDISLAGRILAQFPERLTEDQKV
GNALAELGELAKTPEANIIKLPNISASVPQLKAAIKELQDQGYDIPELPDNATTDEEKDI
LARYNAVKGSAVNPVLREGNSDRRAPIAVKNFVKKFPHRMGEWSADSKTNVATMDANDFR
HNEKSIILDAADEVQIKHIAADGTETILKDSLKLLEGEVLDGTVLSAKALDAFLLEQVAR
AKAEGILFSAHLKATMMKVSDPIIFGHVVRAYFADVFAQYGEQLLAAGLNGENGLAAILS
GLESLDNGEEIKAAFEKGLEDGPDLAMVNSARGITNLHVPSDVIVDASMPAMIRTSGHMW
NKDDQEQDTLAIIPDSSYAGVYQTVIEDCRKNGAFDPTTMGTVPNVGLMAQKAEEYGSHD
KTFRIEADGVVQVVSSNGDVLIEHDVEANDIWRACQVKDAPIQDWVKLAVTRSRLSGMPA
VFWLDPERAHDRNLASLVEKYLADHDTEGLDIQILSPVEATQLSIDRIRRGEDTISVTGN
VLRDYNTDLFPILELGTSAKMLSVVPLMAGGGLFETGAGGSAPKHVQQVQEENHLRWDSL
GEFLALAESFRHELNNNGNTKAGVLADALDKATEKLLNEEKSPSRKVGEIDNRGSHFWLT
KFWADELAAQTEDADLAATFAPVAEALNTGAADIDAALLAVQGGATDLGGYYSPNEEKLT
NIMRPVAQFNEIVDALKK
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atggctaagatcatctggacccgcaccgacgaagcaccgctgctcgcgacctactcgctg
aagccggtcgtcgaggcatttgctgctaccgcgggcattgaggtcgagacccgggacatt
tcactcgctggacgcatcctcgcccagttcccagagcgcctcaccgaagatcagaaggta
ggcaacgcactcgcagaactcggcgagcttgctaagactcctgaagcaaacatcattaag
cttccaaacatctccgcttctgttccacagctcaaggctgctattaaggaactgcaggac
cagggctacgacatcccagaactgcctgataacgccaccaccgacgaggaaaaagacatc
ctcgcacgctacaacgctgttaagggttccgctgtgaacccagtgctgcgtgaaggcaac
tctgaccgccgcgcaccaatcgctgtcaagaactttgttaagaagttcccacaccgcatg
ggcgagtggtctgcagattccaagaccaacgttgcaaccatggatgcaaacgacttccgc
cacaacgagaagtccatcatcctcgacgctgctgatgaagttcagatcaagcacatcgca
gctgacggcaccgagaccatcctcaaggacagcctcaagcttcttgaaggcgaagttcta
gacggaaccgttctgtccgcaaaggcactggacgcattccttctcgagcaggtcgctcgc
gcaaaggcagaaggtatcctcttctccgcacacctgaaggccaccatgatgaaggtctcc
gacccaatcatcttcggccacgttgtgcgcgcttacttcgcagacgttttcgcacagtac
ggtgagcagctgctcgcagctggcctcaacggcgaaaacggcctcgctgcaatcctctcc
ggcttggagtccctggacaacggcgaagaaatcaaggctgcattcgagaagggcttggaa
gacggcccagacctggccatggttaactccgctcgcggcatcaccaacctgcatgtccct
tccgatgtcatcgtggacgcttccatgccagcaatgattcgtacctccggccacatgtgg
aacaaagacgaccaggagcaggacaccctggcaatcatcccagactcctcctacgctggc
gtctaccagaccgttatcgaagactgccgcaagaacggcgcattcgatccaaccaccatg
ggtaccgtccctaacgttggtctgatggctcagaaggctgaagagtacggctcccatgac
aagaccttccgcatcgaagcagacggtgtggttcaggttgtttcctccaacggcgacgtt
ctcatcgagcacgacgttgaggcaaatgacatctggcgtgcatgccaggtcaaggatgcc
ccaatccaggattgggtaaagcttgctgtcacccgctcccgtctctccggaatgcctgca
gtgttctggttggatccagagcgcgcacacgaccgcaacctggcttccctcgttgagaag
tacctggctgaccacgacaccgagggcctggacatccagatcctctcccctgttgaggca
acccagctctccatcgaccgcatccgccgtggcgaggacaccatctctgtcaccggtaac
gttctgcgtgactacaacaccgacctcttcccaatcctggagctgggcacctctgcaaag
atgctgtctgtcgttcctttgatggctggcggcggactgttcgagaccggtgctggtgga
tctgctcctaagcacgtccagcaggttcaggaagaaaaccacctgcgttgggattccctc
ggtgagttcctcgcactggctgagtccttccgccacgagctcaacaacaacggcaacacc
aaggccggcgttctggctgacgctctggacaaggcaactgagaagctgctgaacgaagag
aagtccccatcccgcaaggttggcgagatcgacaaccgtggctcccacttctggctgacc
aagttctgggctgacgagctcgctgctcagaccgaggacgcagatctggctgctaccttc
gcaccagtcgcagaagcactgaacacaggcgctgcagacatcgatgctgcactgctcgca
gttcagggtggagcaactgaccttggtggctactactcccctaacgaggagaagctcacc
aacatcatgcgcccagtcgcacagttcaacgagatcgttgacgcactgaagaagtaa

DBGET integrated database retrieval system