KEGG   Corynebacterium glutamicum MB001: cgp_1266Help
Entry
cgp_1266          CDS       T02791                                 

Gene name
rlmA
Definition
(GenBank) rRNA (guanine(745)-N(1))-methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
cgm  Corynebacterium glutamicum MB001
Brite
KEGG Orthology (KO) [BR:cgm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cgm03009]
    cgp_1266 (rlmA)
Enzymes [BR:cgm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     cgp_1266 (rlmA)
Ribosome biogenesis [BR:cgm03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    cgp_1266 (rlmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_23 Methyltransf_12 Methyltransf_32 Methyltransf_31 Ubie_methyltran
Motif
Other DBs
NCBI-ProteinID: AGT05107
Position
1162761..1163627
Genome map
AA seq 288 aa AA seqDB search
MLSHIIDVLADPIDGTPLVGAEDFSRLVSESGHSYDVARQGYVTLAGGAGLRYSGDDAQM
IADRETFLSGGHFAPFVEAVTEHVQDVVDQAGLSDDAQPVVCEIGAGTGYYLSHTLDSVA
GSRGIGIDVSVHAAKRLAKCHPRVGAVIADAWARLPIADNSVDAITVIFAPRNAAEFARI
LKPKGQVIVLTADTGHLAELREPLGIIDVEAGKVDRMIEQAAGHLKPVGERDLVEFEMLL
DQKSIASQIGMSPSARHIKPEALAERIAALPEQMKVTARAKITRLERI
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtgctttcccacatcattgatgtcctcgccgacccgatcgatggcaccccacttgtaggc
gccgaagatttctcacggttggtgtctgaatctgggcattcctacgatgttgctcgtcaa
gggtatgtcaccctggctggtggcgcaggtctgcgctattcaggcgatgatgcacagatg
atcgcggatcgggaaaccttcctttctggcggtcacttcgcgcccttcgtggaagctgtc
accgagcatgttcaagatgtcgttgaccaggcaggccttagcgatgacgcacagccagtg
gtctgcgaaatcggcgcgggaaccggctactacttgtcccatacccttgattctgttgca
ggatctcgcggaattggcattgacgtttccgtgcacgccgcaaagcgtttggcaaagtgt
caccctcgcgtcggcgcagtcatcgcggacgcatgggcacgcctgccgattgcagataac
tctgtcgatgccatcacggtgattttcgcaccacgcaacgctgcggaatttgcccgcatt
ttgaagccaaagggacaggtcatcgtgcttaccgcagataccggccacttggctgagctt
cgtgaaccactgggcatcattgatgtggaggccggcaaagttgatcgcatgatcgaacaa
gcggcaggccacctcaagccagttggcgaaagagacttggtggaatttgaaatgctgctg
gatcaaaaatccattgcatctcagatcggtatgagcccttctgcacgccacattaagcct
gaggctttggcggaacgcatcgccgctctaccagaacaaatgaaggttacagcccgggcc
aagatcaccaggctggaacgcatctaa

DBGET integrated database retrieval system