KEGG   Corynebacterium glutamicum MB001: cgp_1268Help
Entry
cgp_1268          CDS       T02791                                 

Gene name
glgA
Definition
(GenBank) putative glycosyl transferase
  KO
K16148  alpha-maltose-1-phosphate synthase [EC:2.4.1.342]
Organism
cgm  Corynebacterium glutamicum MB001
Pathway
cgm00500  Starch and sucrose metabolism
cgm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    cgp_1268 (glgA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cgm01003]
    cgp_1268 (glgA)
Enzymes [BR:cgm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.342  alpha-maltose-1-phosphate synthase
     cgp_1268 (glgA)
Glycosyltransferases [BR:cgm01003]
 Polysaccharide
  Storage polysaccharide
   cgp_1268 (glgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_trans_4_4 Glyco_trans_1_2 Glyco_transf_5 Glyco_trans_4_2 TPP_enzyme_M DUF3492
Motif
Other DBs
NCBI-ProteinID: AGT05109
Position
complement(1165272..1166444)
Genome map
AA seq 390 aa AA seqDB search
MRVGMMTREYPPEVYGGAGVHVTELTRFMREIAEVDVHCMGAPRDMEGVFVHGVDPALES
ANPAIKTLSTGLRMAEAANNVDVVHSHTWYAGLGGHLAARLHGIPHVATAHSLEPDRPWK
REQLGGGYDVSSWSEKNAMEYADAVIAVSARMKDSILAAYPRIEPDNVRVVLNGIDTELW
QPRPTFDDAEDSVLRSLGVDPQRPIVAFVGRITRQKGVEHLIKAAALFDESVQLVLCAGA
PDTPEIAARTTALVEELQAKREGIFWVQDMLGKDKIQEILTAADTFVCPSIYEPLGIVNL
EAMACNTAVVASDVGGIPEVVVDGTTGALVHYDENDVETFERDIAEAVNKMVADRETAAK
FGLAGRERAINDFSWATIAQQTIDVYKSLM
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagagtcggaatgatgacaagagagtatccaccagaggtttacggcggcgctggcgtg
cacgtcaccgaattgacccgattcatgcgtgagatcgctgaagttgatgttcactgcatg
ggtgcacctcgcgatatggagggagttttcgtccacggcgtcgatcctgccttggaaagc
gcgaaccctgcgattaagacactgtccaccggtttacgcatggcagaagctgcaaacaac
gtggatgtcgtgcactcacacacttggtatgcaggtcttggcggccaccttgcagctcgt
ctccacggcattcctcacgtggctaccgcgcactctttggagccagatcgcccatggaag
cgtgagcagcttggcggtggatacgacgtgtcctcctggtctgaaaaaaatgccatggaa
tacgctgacgcggtcatcgctgtgtcggctcgcatgaaagattccatcctcgctgcgtac
cctcgcatcgagccggacaacgtgcgtgttgtcctcaacggcatcgacactgagttgtgg
cagcctcgcccgactttcgatgacgcggaagattccgtactccgctccctaggcgttgac
ccacagcggcccatcgtcgcatttgtcggccgcatcacccgccaaaaaggcgtcgagcac
ctcatcaaggcagcagcgcttttcgacgagtccgtgcagcttgtgctctgtgccggcgcg
ccagacacccccgaaatcgcagctcgcaccaccgccctggtggaagaactccaggcaaag
cgcgaaggcattttctgggttcaggacatgctgggcaaggacaaaatccaagagattctc
accgctgctgacaccttcgtgtgcccatccatttacgagccactgggcatcgtgaacttg
gaagcaatggcctgcaacaccgcagttgtcgcatccgacgttggaggcatccctgaggtt
gttgtcgacggcaccaccggcgccctcgttcactacgacgaaaatgatgtcgaaaccttc
gagcgcgatatcgccgaagcggtgaataaaatggtcgctgatcgagagaccgcagccaaa
tttggtctcgcagggcgcgaacgtgctatcaatgatttctcctgggcaacgattgctcag
cagaccattgatgtgtacaaatccttgatgtaa

DBGET integrated database retrieval system