KEGG   Corynebacterium glutamicum MB001: cgp_1463Help
Entry
cgp_1463          CDS       T02791                                 

Gene name
gltS
Definition
(GenBank) putative glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
cgm  Corynebacterium glutamicum MB001
Pathway
cgm00860  Porphyrin and chlorophyll metabolism
cgm00970  Aminoacyl-tRNA biosynthesis
cgm01100  Metabolic pathways
cgm01110  Biosynthesis of secondary metabolites
cgm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cgm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    cgp_1463 (gltS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    cgp_1463 (gltS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cgm01007]
    cgp_1463 (gltS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cgm03016]
    cgp_1463 (gltS)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:cgm02048]
    cgp_1463 (gltS)
Enzymes [BR:cgm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     cgp_1463 (gltS)
Amino acid related enzymes [BR:cgm01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   cgp_1463 (gltS)
Transfer RNA biogenesis [BR:cgm03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    cgp_1463 (gltS)
 Prokaryotic Type
   Other AARSs
    cgp_1463 (gltS)
Prokaryotic defense system [BR:cgm02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    cgp_1463 (gltS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: AGT05277
Position
1364266..1365747
Genome map
AA seq 493 aa AA seqDB search
MTDVRVRFCPSPTGTPHVGLVRTALFNWAYARHTGGKLVFRIEDTDAARDSEESYSAIID
SLRWLGMDWDEGVEKGGPHEPYRQSQRKDIYQDVLKQLIDAGEVYPAYSTAEEVEERHKA
AGRDPKLGYDNFDRDLTEEQVAAFEAEGRKPVWRLRMPEQDWKWTDLVRGEVEFKSFTQP
DFVVARSNGEPLYTLVNPVDDALMEVTHVLRGEDLLPSTPRQLALYEALKRIGVAKATPA
FGHLPFVMGEGNKKLSKRDPQSSLFNHRDNGIIPEGMLNYLALLGWSLSADQDIFGVDEL
IANFDVADVLGNPARFDQKKLEAINADHIRLLEPKDFEARLRAYMTEYTEFPADYPAEKF
AIAAELVQTRIKVLSEAWDLLKFLVTADEDLVFNEKAAKKNLKETAVEPLNAGIAALEAV
EEWTTPNIEAALNKALIEDLGLKPRVAFGALRIGISGEAVSPPLFESMELLGKESTLVRL
KVTREQTPFVVAE
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgactgatgttcgtgttcgtttctgcccatcgcccaccggcaccccacacgttggactt
gtgcgcaccgcgctgttcaactgggcatatgctcgccacactggaggcaagttagttttc
cgcattgaggacactgacgctgcccgcgattccgaggagtcttactccgccatcatcgat
tccctgcgctggttgggaatggactgggatgagggtgtggaaaagggcggcccgcatgag
ccctaccgccagtcgcagcgcaaggacatctatcaggatgtgttgaagcagcttatcgac
gccggtgaagtctacccagcttattccaccgcggaagaggttgaggagcgacacaaggct
gctggccgcgatccaaagctcggctacgacaactttgaccgtgatctcaccgaagagcag
gtcgcagcatttgaggctgaggggcgtaagcctgtgtggcgtctgcgcatgccagagcag
gattggaagtggactgacctggtccgcggtgaagttgagttcaagtcgttcacccagcct
gacttcgtggttgctcgttccaacggtgagcctttgtacaccctggtcaaccctgttgat
gatgcgttgatggaagtcacccatgtgctgcgtggtgaggatcttttgccatcgactcct
cgtcagcttgctctgtatgaggcgctcaagcgcattggcgtggcaaaggccaccccagcc
tttggtcacctgccatttgtgatgggtgagggcaacaagaagctgtctaagcgtgatcca
cagtccagcctgttcaaccaccgtgacaacggcatcatcccagagggcatgctcaactac
ctggcgctgctgggttggtcactgtctgctgatcaggacattttcggtgtcgatgagttg
atcgctaactttgatgtcgctgacgtgttgggcaacccagctcgctttgaccagaagaag
cttgaggccatcaacgcggatcacatccgacttctggagcctaaggatttcgaggctcgc
ctgcgcgcgtacatgactgagtacaccgagttcccagcggattacccagctgagaagttt
gccattgctgcggagctggttcagacccgcatcaaggtgctcagcgaggcgtgggatctg
ctgaagttcctggtcaccgctgacgaagatctggtgttcaatgagaaggctgccaagaag
aacctcaaggagaccgctgttgagcctctcaacgccggtatcgcagcgctggaggcagtg
gaggagtggaccactccaaacattgaagcagcattgaacaaggctctcattgaggatcta
ggcctgaagcctcgcgtggcgttcggtgcgttgcgcattggtatctccggcgaggctgta
tccccaccactgtttgagtccatggagcttttgggcaaggaatccacgttggttcgtctg
aaggttactcgtgagcagaccccattcgtggtcgctgagtaa

DBGET integrated database retrieval system