KEGG   Corynebacterium glutamicum MB001: cgp_1678Help
Entry
cgp_1678          CDS       T02791                                 

Gene name
cobL
Definition
(GenBank) precorrin-6Y C(5,15)-methyltransferase (decarboxylating)
  KO
K00595  precorrin-6Y C5,15-methyltransferase (decarboxylating) [EC:2.1.1.132]
Organism
cgm  Corynebacterium glutamicum MB001
Pathway
cgm00860  Porphyrin and chlorophyll metabolism
cgm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    cgp_1678 (cobL)
Enzymes [BR:cgm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.132  precorrin-6B C5,15-methyltransferase (decarboxylating)
     cgp_1678 (cobL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase
Motif
Other DBs
NCBI-ProteinID: AGT05450
Position
complement(1552453..1553745)
Genome map
AA seq 430 aa AA seqDB search
MSQPMSAPDSAPGTERGHERTHFAVVGDSQDPAQATAPRAPAESITLIGIGTDGFEGLGL
KAQQALQRASVVIGSWRQLNLVPDAIKAERRPWPGNTKHPDLDALFKEFLGRHVAVLASG
DPLFYGVGTAMVHVLGMDRLTVIPGPSSASLACARLGWTVNRTRVVYLGQEPIETLIPII
ESGAQFLVLGKDEFSTAQVATLLNELGLGETPLTVLSDLGSTDEEITQGTASHPPAAVSV
LNVIAVGARTAMPKPHFEGDVSNEDLRALTVAALEPTQGQMLWTFGDIGAALACDWLRAA
GNKAHAISFASMVEQSQRNARKLGVSTLSVKETLSPKTLKDIRYVQGPESASPHAIFMNK
GLGIDLVPETAWMMLRPGGKLIAQASTEDNIAKLHTLQEQHGGIIKHIRIDDTDVHQWRV
TKPVTPEAVN
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaccgatgtcagcacccgactccgctccaggaacagagcgcggtcatgaacgc
acccattttgcggtagtcggtgactcccaggatccagcacaggcaacagctcctagagcg
ccagcagaatcaattactttgattggtattggtaccgatgggtttgaggggctcggactc
aaggcacagcaagcattacaacgtgcctctgtggtgattggatcatggcgccagctcaat
ctcgtacctgatgccattaaggcagagcgtcgcccatggccgggtaataccaagcatcct
gatttagatgccttgtttaaagagttcctcggtcggcatgttgctgttctggcctctggc
gatccactgttttacggcgtgggcaccgcaatggtccatgtgctggggatggatagactc
acggttattccgggaccatcatccgcgtcgcttgcttgcgcccgcttgggttggacagtc
aaccgcacacgggtggtgtacctaggacaagaacccattgagacactcatcccgattatt
gaatcaggcgctcaattcctcgtcttgggtaaagatgaattcagtacagctcaagttgcc
acgttgttgaatgaactcggactgggggagactccactgactgtgctcagcgatttgggc
agtactgatgaggagatcacccaaggcacagcttcacatccaccagctgcagtgtctgtt
ctcaacgtgattgctgtgggagctcgcaccgcaatgccgaaaccccactttgaaggcgac
gtatcaaacgaagaccttcgggcactgaccgtggcagctctagaacccacccagggacaa
atgctgtggaccttcggggatattggagcagcacttgcctgcgattggctacgcgcagcc
ggcaacaaggcgcacgccattagttttgcctccatggttgagcaaagccaaaggaatgct
cgcaaactaggtgtatccaccctcagtgtgaaagagaccctgtcacccaaaacgctcaaa
gatatccgctatgtacaaggaccagaatcagcaagcccacatgccatcttcatgaacaaa
ggcctaggcatcgatctagttcctgaaaccgcatggatgatgctgcggcctggaggaaag
ctcattgcgcaagcctccacagaagacaacatcgcaaagcttcacacactccaagaacaa
cacggcggaatcatcaaacacatccgcatcgacgacacagacgtgcaccaatggcgagtt
acaaagccggtgactccagaagcggtgaattag

DBGET integrated database retrieval system