KEGG   Corynebacterium glutamicum MB001: cgp_2192Help
Entry
cgp_2192          CDS       T02791                                 

Gene name
mqo
Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
cgm  Corynebacterium glutamicum MB001
Pathway
cgm00020  Citrate cycle (TCA cycle)
cgm00620  Pyruvate metabolism
cgm01100  Metabolic pathways
cgm01110  Biosynthesis of secondary metabolites
cgm01120  Microbial metabolism in diverse environments
cgm01130  Biosynthesis of antibiotics
cgm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cgm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    cgp_2192 (mqo)
   00620 Pyruvate metabolism
    cgp_2192 (mqo)
Enzymes [BR:cgm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     cgp_2192 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3 Pyr_redox_2 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AGT05741
Position
complement(1880453..1881955)
Genome map
AA seq 500 aa AA seqDB search
MSDSPKNAPRITDEADVVLIGAGIMSSTLGAMLRQLEPSWTQIVFERLDGPAQESSSPWN
NAGTGHSALCELNYTPEVKGKVEIAKAVGINEKFQVSRQFWSHLVEEGVLSDPKEFINPV
PHVSFGQGADQVAYIKARYEALKDHPLFQGMTYADDEATFTEKLPLMAKGRDFSDPVAIS
WIDEGTDINYGAQTKQYLDAAEVEGTEIRYGHEVKSIKADGAKWIVTVKNVHTGDTKTIK
ANFVFVGAGGYALDLLRSAGIPQVKGFAGFPVSGLWLRCTNEELIEQHAAKVYGKASVGA
PPMSVPHLDTRVIEGEKGLLFGPYGGWTPKFLKEGSYLDLFKSIRPDNIPSYLGVAAQEF
DLTKYLVTEVLKDQDKRMDALREYMPEAQNGDWETIVAGQRVQVIKPAGFPKFGSLEFGT
TLINNSEGTIAGLLGASPGASIAPSAMIELLERCFGDRMIEWGDKLKDMIPSYGKKLASE
PALFEQQWARTQKTLKLEEA
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtcagattccccgaagaacgcaccgaggattaccgatgaggcagatgtagttctcatt
ggtgccggtatcatgagctccacgctgggtgcaatgctgcgtcagctggagccaagctgg
actcagatcgtcttcgagcgtttggatggaccggcacaagagtcgtcctccccgtggaac
aatgcaggaaccggccactctgctctatgcgagctgaactacaccccagaggttaagggc
aaggttgaaattgccaaggctgtaggaatcaacgagaagttccaggtttcccgtcagttc
tggtctcacctcgttgaagagggagtgctgtctgatcctaaggaattcatcaaccctgtt
cctcacgtatctttcggccagggcgcagatcaggttgcatacatcaaggctcgctacgaa
gctttgaaggatcacccactcttccagggcatgacctacgctgacgatgaagctaccttc
accgagaagctgcctttgatggcaaagggccgtgacttctctgatccagtagcaatctct
tggatcgatgaaggcaccgacatcaactacggtgctcagaccaagcagtacctggatgca
gctgaagttgaaggcactgaaatccgctatggccacgaagtcaagagcatcaaggctgat
ggcgcaaagtggatcgtgaccgtcaagaacgtacacactggcgacaccaagaccatcaag
gcaaacttcgtgttcgtcggcgcaggcggatacgcactggatctgcttcgcagcgcaggc
atcccacaggtcaagggcttcgctggattcccagtatccggcctgtggcttcgttgcacc
aacgaggaactgatcgagcagcacgcagccaaggtatatggcaaggcatctgttggcgct
cctccaatgtctgttcctcaccttgacacccgcgttatcgagggtgaaaagggtctgctc
tttggaccttacggtggctggacccctaagttcttgaaggaaggctcctacctggacctg
ttcaagtccatccgcccagacaacattccttcctaccttggcgttgctgctcaggaattt
gatctgaccaagtaccttgtcactgaagttctcaaggaccaggacaagcgtatggatgct
cttcgcgagtacatgccagaggcacaaaacggcgattgggagaccatcgttgccggacag
cgtgttcaggttattaagcctgcaggattccctaagttcggttccctggaattcggcacc
accttgatcaacaactccgaaggcaccatcgccggattgctcggtgcttcccctggagca
tccatcgcaccttccgcaatgatcgagctgcttgagcgttgcttcggtgaccgcatgatc
gagtggggcgacaagctgaaggacatgatcccttcctacggcaagaagcttgcttccgag
ccagcactgtttgagcagcagtgggcacgcacccagaagaccctgaagcttgaggaagcc
taa

DBGET integrated database retrieval system