KEGG   Corynebacterium glutamicum MB001: cgp_2625Help
Entry
cgp_2625          CDS       T02791                                 

Gene name
pcaF
Definition
(GenBank) putative beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cgm  Corynebacterium glutamicum MB001
Pathway
cgm00071  Fatty acid degradation
cgm00072  Synthesis and degradation of ketone bodies
cgm00280  Valine, leucine and isoleucine degradation
cgm00310  Lysine degradation
cgm00362  Benzoate degradation
cgm00380  Tryptophan metabolism
cgm00620  Pyruvate metabolism
cgm00630  Glyoxylate and dicarboxylate metabolism
cgm00640  Propanoate metabolism
cgm00650  Butanoate metabolism
cgm00900  Terpenoid backbone biosynthesis
cgm01100  Metabolic pathways
cgm01110  Biosynthesis of secondary metabolites
cgm01120  Microbial metabolism in diverse environments
cgm01130  Biosynthesis of antibiotics
cgm01200  Carbon metabolism
cgm01212  Fatty acid metabolism
cgm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cgm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    cgp_2625 (pcaF)
   00630 Glyoxylate and dicarboxylate metabolism
    cgp_2625 (pcaF)
   00640 Propanoate metabolism
    cgp_2625 (pcaF)
   00650 Butanoate metabolism
    cgp_2625 (pcaF)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    cgp_2625 (pcaF)
   00072 Synthesis and degradation of ketone bodies
    cgp_2625 (pcaF)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    cgp_2625 (pcaF)
   00310 Lysine degradation
    cgp_2625 (pcaF)
   00380 Tryptophan metabolism
    cgp_2625 (pcaF)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    cgp_2625 (pcaF)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    cgp_2625 (pcaF)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    cgp_2625 (pcaF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cgm04147]
    cgp_2625 (pcaF)
Enzymes [BR:cgm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     cgp_2625 (pcaF)
Exosome [BR:cgm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   cgp_2625 (pcaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGT06120
Position
2302415..2303641
Genome map
AA seq 408 aa AA seqDB search
MNPQDIVICSPLRTPVGAYGGSFTGVPVEELATTVINAIVEATGITGDDVDDLILGQASP
NGAAPALGRVVALDSKLGQNVPGMQLDRRCGSGLQAIVTAAAHVASGAADLIIAGGAESM
SRVEYTVSGDIRWGVKGGDMQLRDRLAEARETAGGRNHPIPGGMIETAENLRREYGISRE
EQDKISAASQQRWGKAADAGLFDDEIVPVTVPAKKRGQEPTIVSRDEHGRPGTTVEKLAA
LRPIMGRQDAEATVTAGNASGQNDGAAAVIVTTRAKAEEKGLRPVMRLAGWSVAAVPPET
MGIGPVPATKKVLDRLGLTLEDIGAIELNEAFAAQALSVLKEWNISWEDERVNPLGSGIS
MGHPVGATGARMAVTLAHRMQRENTQYGLATMCIGGGQGLAAVFEKEN
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaccctcaagatattgtcatctgttccccattgcgcaccccagttggtgcttacggc
ggatccttcaccggcgtccctgttgaagaattggccaccaccgtgatcaacgcgatcgtt
gaggcaaccggcatcaccggcgacgatgtggacgatctgatcctcggccaggcatccccc
aacggtgcggctccagcactgggccgtgttgttgctctagattccaagcttggccaaaac
gttccaggcatgcagcttgatcgccgctgtggttccggcctgcaggcaatcgtcaccgct
gctgcacacgttgcatccggcgctgctgatctgatcatcgcaggtggcgcagaatccatg
agccgcgttgagtacaccgtgtccggcgatatccgttggggtgtcaagggcggcgacatg
cagcttcgtgaccgccttgcagaagcacgcgaaaccgctggcggacgcaaccacccgatc
cctggtggcatgatcgagaccgctgagaacctgcgtcgcgaatacggcatctcccgcgag
gagcaggacaagatctccgcagcgtcccagcagcgttggggcaaggctgctgatgcgggg
cttttcgacgacgagatcgtgccagtcaccgtccctgccaagaagcgcggccaggagcca
accatcgtttctcgagacgagcatggtcgaccaggaacaaccgtcgaaaagcttgctgct
ttgcgccccatcatgggccgccaggatgcggaagcaaccgtcaccgctggcaacgcgtcc
ggccaaaatgatggcgctgctgccgtcatcgtgaccactcgcgccaaggccgaggagaag
ggcctgcgcccagtcatgcgtttggctggctggtctgtggctgctgttcccccagagacc
atgggtattggacctgttcctgccaccaagaaggtcctggatcgtttgggccttaccctg
gaggacatcggcgcgatcgaactcaacgaagctttcgcagctcaggcactgtctgtgctg
aaggaatggaacatttcttgggaagatgagcgcgtcaacccactgggttccggtatttcc
atgggacacccagtcggtgccaccggtgctcgcatggcagtaaccttggctcaccgcatg
cagcgtgaaaacactcagtacggactggccaccatgtgcatcggtggcggccagggtctt
gcagctgtctttgaaaaggagaactaa

DBGET integrated database retrieval system