KEGG   Chryseobacterium gallinarum: OK18_03110Help
Entry
OK18_03110        CDS       T03954                                 

Definition
(GenBank) histidine decarboxylase
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
cgn  Chryseobacterium gallinarum
Pathway
cgn00340  Histidine metabolism
cgn01100  Metabolic pathways
cgn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cgn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    OK18_03110
Enzymes [BR:cgn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     OK18_03110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AKK71762
UniProt: A0A0G3M409
Position
672535..673665
Genome map
AA seq 376 aa AA seqDB search
MKNLTPEDKNRIDELKNHLQERKNHLLGYPVTLNFDYSLLYKFLQYPVNNAGDPFYMDGS
HHMNTHSIEREVIHFFANLLKAPENNYWGYVTNGSSEGNLYALYLAKRLYPGGVVYFSEE
SHYSIEKNIDILGLNYQKVKSQPHGEIDYKDFEEKILLHQDQPAIIIANIGTTFKEAKDD
IKPIQDILGKCKVKKYYIHCDAAFCGSYAQFLSPKPHFDFSEGADSIIVSGHKFLGSPIP
CGIIIVLKHNKERISNYVDVLDSLDDTITGSRNAITPLIIWYMIRTVGTEGIHHQLNECL
NLAAYTQIKINHLGIKALRNPNALTIIFPRVSKALQYKWQLAAHGAFSHLIIRPGITKDM
IDSFITDLKNDVNYRK
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacttgacaccagaagacaaaaacagaattgatgaattaaaaaatcatttgcaa
gaaagaaaaaatcatctattgggatatcctgtaacacttaactttgattattctttgctt
tataaattccttcaatatcctgtaaacaacgccggagatccgttttatatggacgggtct
caccatatgaatacgcattctatagaaagagaggtcatccatttttttgccaatttacta
aaggcgccggaaaataattattgggggtacgttaccaatggcagctcagaaggtaatctt
tatgcactttatttagccaagcgtttatatcccggaggggtggtttacttttctgaagaa
tcccattacagtattgaaaaaaatattgatatattaggcttaaattatcaaaaagtaaaa
tcccagcctcacggagagatagattataaagattttgaagagaaaatcttgctccatcag
gatcagcctgcaatcatcattgccaatattgggaccaccttcaaggaggcaaaggatgat
atcaaacctatccaggacattttaggcaaatgcaaagtaaaaaaatattatatccactgt
gatgctgcattttgtgggagttatgcccagtttttatctccaaaaccgcattttgatttt
agtgaaggagcggattctattattgtaagcggacataaatttctagggtcccctattccc
tgtggaataatcattgtactaaagcacaataaagaaagaatttcaaattatgtggatgtt
ctggacagtttagatgatacgattaccggatcacgtaatgccattactcctctgataata
tggtatatgatcagaaccgttggtacagaaggaattcatcatcagcttaatgagtgtctt
aatttagcggcgtatacccagatcaaaataaaccatcttggaattaaagccttgcgcaat
ccgaacgcccttacaataatttttccccgcgtaagcaaggcactccagtataaatggcaa
ttggcagctcatggtgcattcagccacctcattatcagaccgggaatcacaaaagatatg
atagattcttttattacagatttaaagaacgacgtcaattatcggaaataa

DBGET integrated database retrieval system