KEGG   Chryseobacterium gallinarum: OK18_05915Help
Entry
OK18_05915        CDS       T03954                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
cgn  Chryseobacterium gallinarum
Pathway
cgn00730  Thiamine metabolism
cgn00790  Folate biosynthesis
cgn01100  Metabolic pathways
cgn02020  Two-component system
Module
cgn_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cgn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    OK18_05915
   00790 Folate biosynthesis
    OK18_05915
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    OK18_05915
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cgn04147]
    OK18_05915
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cgn00537]
    OK18_05915
Enzymes [BR:cgn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     OK18_05915
Exosome [BR:cgn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OK18_05915
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cgn00537]
 Enzymes
  OK18_05915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase GDPD_2 Phosphodiest Metalloenzyme
Motif
Other DBs
NCBI-ProteinID: AKK72237
UniProt: A0A0G3M5C8
Position
complement(1303585..1305408)
Genome map
AA seq 607 aa AA seqDB search
MKLSKILAVLALAAFTENQAQNYLNYSVENAHSHNDYMQEVPFWQAYYAQFGSIEADVFL
VKGKLWVAHTEKELSAGRTLENLYLDTISKQIKLNKGNIYPDPNRKLQLLIDIKQNYKTS
LNALVNTLKKYPEITGNSGIKIVITGGRPQPDDFKNYPDYLYFDGDPDKNYTEDQLKRIG
MFSADLPGLVKWNGKGIPRDEETAKIKSVVEKAHARKKPVRFYGAPDFPNAWVNLMDLGV
DYINTDHIPDLKKFMNTIPKNFYKNTKEYATYTPTYKTDGIDKKVKNVILLIPDGTSLPQ
YYAAFTANKGKLNVFNMKATGLSKTNSSNAYITDSAPGSTAFATGVKTKNTFVGVDGMGK
ALAQIPDIIAAKGMVSGLISTGDVTDATPADFYAHSDNRNSSELILKDFITSKAKILIGG
PTNGLTRETEQKLKEAKVDIYHDLKSATTSNRTLVIDPLASQRITDGRGNWLADAFDLTL
NDLKNNKKGFFMMVEASQTDGGGHSNNMEQLVTELLDFDHVVGKAMKFADENKETLVVVV
GDHETGGLTLLDGSLREGWVFGNFSTNDHTSIPSNVFAYGPNSKEFTGLFENTEIFNKIM
AAYGIQK
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgaaactatcaaaaatattggctgtattggctctggcagcttttactgaaaatcaggct
cagaattatttaaactatagtgtggaaaacgcacattcacacaatgactatatgcaggaa
gttcctttctggcaggcgtattatgcacagtttggttctattgaagccgatgtttttctg
gtaaaagggaaattatgggtagcacatacggaaaaagaactctcagccggcagaacgctg
gagaacctctatctggatactatttccaaacagataaagctgaataagggaaatatttac
ccggatcccaatagaaaattacaattgctcatcgatatcaagcagaattataaaacgagc
ctgaatgcattggtaaacaccttaaaaaagtatcctgaaattacaggaaacagcgggatt
aaaattgtcattacaggaggaaggccacaaccggacgattttaagaactacccagattac
ctttatttcgatggggatcctgataaaaattacacagaagatcagttaaaaagaattgga
atgttcagtgctgacctccctgggctcgtaaaatggaatgggaaaggaattccaagagat
gaagaaacagcgaaaataaaatcagttgtagaaaaagcacatgctcggaaaaaaccggta
cgcttttatggagcccctgattttcccaatgcatgggtgaatctgatggaccttggagtg
gattatatcaacaccgaccatatcccggatcttaagaagttcatgaatactattcctaag
aacttttacaagaatacaaaagaatatgcaacttatactccaacctataaaacagatggt
attgataaaaaagtaaaaaatgtaattctcctgattccggacggaacttccttaccgcaa
tattatgccgcatttactgccaacaaagggaagctgaatgttttcaatatgaaagcaaca
gggctctctaaaaccaattcttccaatgcctatattacagattcagccccgggatctaca
gcatttgctaccggagtgaaaactaaaaatacctttgtaggagttgacggaatgggaaaa
gcattggcacagattcctgatattatcgcggctaaaggaatggtttccggtttaatttct
accggagatgttaccgatgctaccccggcagatttttacgcccattcagacaacagaaac
agttcagaactgatacttaaagattttattacctctaaagcaaaaatcctgatcggcgga
cctaccaatggattaacccgggagacggagcaaaagctgaaagaagcaaaagtagatatt
tatcacgatctgaaatcagccacaaccagtaatcgtacgctggtaatagatcctttagcc
tcccaaagaatcaccgatggacgaggtaactggcttgccgatgcatttgatcttactttg
aatgatttaaaaaataataaaaaaggcttctttatgatggtggaagcttctcaaacagat
ggaggtggacatagcaataatatggaacagctggttaccgaattactagattttgaccat
gtggtaggaaaagcgatgaagtttgcagatgaaaataaagaaacattagtagtggtggta
ggagaccatgaaacgggagggttaacccttcttgatggaagtctcagggaaggctgggta
ttcggaaactttagtaccaatgatcatacttcgatcccgtcaaatgtttttgcttatggc
ccgaattctaaagaatttacggggttgtttgaaaatacagagatcttcaataagattatg
gctgcttacgggatccaaaaatag

DBGET integrated database retrieval system