KEGG   Chryseobacterium gallinarum: OK18_14980Help
Entry
OK18_14980        CDS       T03954                                 

Definition
(GenBank) glycine cleavage system protein T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
cgn  Chryseobacterium gallinarum
Pathway
cgn00260  Glycine, serine and threonine metabolism
cgn00630  Glyoxylate and dicarboxylate metabolism
cgn00670  One carbon pool by folate
cgn01100  Metabolic pathways
cgn01110  Biosynthesis of secondary metabolites
cgn01130  Biosynthesis of antibiotics
cgn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cgn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    OK18_14980
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OK18_14980
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    OK18_14980
Enzymes [BR:cgn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     OK18_14980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG DUF3659
Motif
Other DBs
NCBI-ProteinID: AKK73734
UniProt: A0A0G3M4E9
Position
complement(3337282..3338358)
Genome map
AA seq 358 aa AA seqDB search
MKKTALYDKHVSLGAKIVPFAGFEMPVQYSGVTEEHFAVREKAGLFDVSHMGQFFIEGPG
SKDLLQLVTTNNVDALENGKAQYSCLPNENGGIVDDLIVYKMEDDKYFVVVNASNIDKDW
NHISKYNTFGAKMTNASDEMSLLAIQGPKATEILQKLTEVNLSEIPYYHFTVGSVAGVNN
VIISNTGYTGSGGFEIYFSNEHAEKLWDEIIKAGEAEGIIPCGLAARDTLRLEKGFCLYG
NDIDDTTSPIEAGLGWITKFDKDFVSKDVFAKQKEEGVTRKLVGFELQDKGVPRHDYPVV
DAEGNIIGKVTSGTQSPMKKIGLGLAYVDKPYFKLGSEIFIQVRNKNIPAKVVKAPFV
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaacagccttgtacgacaaacatgtttctttgggagctaagatcgtacctttc
gcaggttttgaaatgcctgtacaatattcaggagtaacggaagagcattttgcagtaaga
gaaaaagcaggattatttgatgtttcccatatgggacagtttttcattgaaggcccgggc
tcgaaagatcttttacagctggtaactaccaataatgtagatgctcttgaaaacggtaag
gcacaatattcttgtcttcccaatgagaatggaggaattgtggatgatcttatcgtttac
aaaatggaggatgacaaatacttcgtggttgtgaatgcttcaaatattgataaagactgg
aatcatatttcaaaatacaatactttcggagctaaaatgaccaatgcttctgatgagatg
tcattgctggctatccagggccctaaggctacggagattcttcaaaaacttacggaagta
aatctttcagaaattccttactatcattttacagtaggaagtgttgccggagtaaacaac
gttattatttccaacacaggatatacaggaagcgggggttttgaaatttatttcagcaat
gaacacgcagaaaaactttgggatgaaatcatcaaagcaggtgaagcagaaggaattatt
ccttgcggattagctgccagagatactttaagactggaaaaaggattctgtctgtacgga
aatgacattgatgatactacctctccaattgaagcggggttaggatggatcaccaagttt
gacaaagattttgtttctaaagatgtgtttgccaagcaaaaagaggaaggggttaccaga
aaacttgtaggctttgagcttcaggataaaggggttccaagacatgattaccctgttgtg
gatgcagaaggaaacattatcggaaaagtaacttcaggaacacagtctccgatgaaaaaa
ataggtttaggacttgcttatgtagacaaaccttatttcaaactgggttctgaaatcttc
atccaggtaagaaataaaaacattcctgcaaaagtagtaaaagctccttttgtataa

DBGET integrated database retrieval system