KEGG   Chryseobacterium gallinarum: OK18_15055Help
Entry
OK18_15055        CDS       T03954                                 

Definition
(GenBank) chromosomal replication initiation protein
  KO
K02313  chromosomal replication initiator protein
Organism
cgn  Chryseobacterium gallinarum
Pathway
cgn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cgn00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    OK18_15055
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cgn03032]
    OK18_15055
   03036 Chromosome and associated proteins [BR:cgn03036]
    OK18_15055
DNA replication proteins [BR:cgn03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    OK18_15055
Chromosome and associated proteins [BR:cgn03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    OK18_15055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DnaA Bac_DnaA_C IstB_IS21 DnaA_N AFG1_ATPase AAA RNA_helicase AAA_22
Motif
Other DBs
NCBI-ProteinID: AKK73747
UniProt: A0A0G3M9M3
Position
3352173..3353627
Genome map
AA seq 484 aa AA seqDB search
MDENLMMIWQRCLQFMRDNLNAAEDNSDLKKLEKSFDLLFDKVQPFSLVDNNLTLMVPSD
FYKEYIEDNYLSLLSAALKKNIGKGVKLWYSVMENRPSGLEKPVTMNMKGKSVPTPKVQE
TMPQGFSSNIVNPFVVPGIKKVNIDSNLKADFSFDNYVEGESNKFAATVARSIAKRPGAT
AFNPLFLYGGYGVGKTHLGQAVGLEVKNQFPDKVVLYLSSEKFIQQFISAAKAHKQTEFA
NFYQMVDVLIIDDIQFLSGKSATQDSFFHIFDHLHQNGKQIILTSDKAPADIMDIQDRIV
SRFKWGLSAEIKSPDLTTRKKIIENKLSRDGIVLPDDMLEFLAAEAKTNVRELIGIINSV
IAYSTIYKTDLSLELLKETINKIAANQKKIINIPYIQEVVCDYFGIKKEQLLSKTRKREI
ALPRQLAMYFSKEFTNATFTKIGEEMGGKDHSTVMYACDTIKDVSKIDKEVKKYVKDLTE
RIKS
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaaatttaatgatgatatggcagaggtgtcttcagtttatgcgtgataatttg
aacgcggctgaggataattctgatttaaaaaagcttgaaaaatcttttgatttattgttt
gataaagtacagccattttcattggttgataacaacctgaccttgatggttcccagtgat
ttctataaagaatatatagaagacaattacttatcgcttctttcagcagccctgaaaaaa
aatattggaaaaggcgttaaattatggtattcagtaatggaaaacaggccaagtggactg
gagaaacctgttaccatgaatatgaaaggaaaaagtgtaccgactcctaaagtgcaggag
acgatgccgcaaggattctcatccaatattgtaaatccgtttgtagtgccgggaatcaag
aaagtaaatattgattctaatttgaaggccgacttctctttcgataattatgtggaagga
gaaagtaataaatttgccgctacggttgcaagatcaatcgcaaaaagacccggtgcaaca
gcttttaacccgttatttttatatggaggttatggagtagggaaaacccacttaggccag
gcggtaggactggaagtaaaaaaccagtttcctgataaggtagttctttatttgtcttca
gagaaatttatccagcaattcatctctgctgcgaaagctcataagcagacagaatttgcc
aacttctaccagatggtggatgtattgattattgatgatatccagttcttatccggaaaa
tctgctactcaggacagtttcttccatatttttgatcacctgcatcaaaatggaaaacaa
attatccttacgtcagataaagcgcctgctgacatcatggatattcaggacagaattgtt
tcccgtttcaaatggggactttctgcagaaatcaaatctcctgaccttactacacggaag
aaaattattgagaataaactgagcagggacggaattgttcttcctgatgatatgcttgag
ttccttgctgcagaagctaaaaccaatgtaagagaacttatcgggattattaactctgtg
attgcttattctactatttataaaacagatcttagcttagaattattaaaagagactatt
aataagattgctgccaatcaaaagaaaattatcaatattccttatatacaggaagttgtt
tgtgattatttcgggatcaaaaaagagcagcttttatctaaaacaagaaaaagagaaatt
gcgcttccaagacagctggctatgtatttttcaaaagaatttaccaacgctacctttacc
aaaattggtgaagaaatgggaggaaaagaccattctactgtaatgtatgcctgtgatacc
atcaaggatgtatcaaaaattgataaagaagtcaagaagtatgtaaaagaccttacagaa
agaatcaaaagttag

DBGET integrated database retrieval system