KEGG   Chryseobacterium gallinarum: OK18_18310Help
Entry
OK18_18310        CDS       T03954                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cgn  Chryseobacterium gallinarum
Pathway
cgn00480  Glutathione metabolism
cgn00590  Arachidonic acid metabolism
cgn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    OK18_18310
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    OK18_18310
Enzymes [BR:cgn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     OK18_18310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AKK74296
UniProt: A0A0G3M544
Position
complement(4117688..4118263)
Genome map
AA seq 191 aa AA seqDB search
MKKIFLLLLSFMAFLQSCTNQKSEISKAKTKELMGKTIYDFKVESLDGKEINFADFKGKK
ILIVNTASECGFTPQYADLEKVYEQYKDKLVVVGFPANNFGGQEPGTNTEIGAFCQKNYG
VTFPMAAKVSVKGDDMAPIFKYLTEQELNGVKNTTILWNFTKFLIDENGKLIDTYVSTTK
PTSEAITKHLK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatttttttactgctgctctcctttatggcatttttgcagagctgcaccaat
caaaaaagcgaaatttctaaagctaaaaccaaagaacttatgggaaaaacgatatacgac
ttcaaagtggaaagcctggatggtaaagaaatcaactttgcagactttaaagggaagaaa
atccttattgtcaacactgcttcagaatgtggttttactccacagtatgcagatcttgaa
aaagtatatgagcagtataaagataaactggtagtggtaggatttccagccaataatttt
ggagggcaggagccgggaaccaatactgaaatcggagcattctgccagaaaaattatgga
gtcacatttccaatggccgcaaaagtttctgtaaaaggggatgatatggcacctatcttt
aaatatttaacagaacaggaattaaacggagtaaaaaataccacgatcctttggaacttt
acgaaattcctgatcgatgaaaacggaaaactgattgatacgtatgtaagtactaccaag
ccgacaagcgaggcaattacaaaacatctgaaataa

DBGET integrated database retrieval system