KEGG   Chryseobacterium gallinarum: OK18_18790Help
Entry
OK18_18790        CDS       T03954                                 

Definition
(GenBank) magnesium transporter
  KO
K06195  ApaG protein
Organism
cgn  Chryseobacterium gallinarum
Brite
KEGG Orthology (KO) [BR:cgn00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    OK18_18790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AKK74384
UniProt: A0A0G3M651
Position
complement(4219592..4219981)
Genome map
AA seq 129 aa AA seqDB search
MMFSKMTSNIKVSVIPEYDSKNSYPSENRYVFKYSITIENDGSFPIKVLKRKWLIFDVGF
GYTEIIGDGVIGLTPEIGTNENFAYFSNVMLRSGVGNMSGKYLVKNLETQETFEIDIPKF
NLLSEVLSN
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgatgttttcaaaaatgacttccaatatcaaagtttcagtaatacctgaatatgatagt
aaaaacagttacccatccgaaaaccgatatgttttcaaatacagtatcactatagaaaat
gatggaagctttcctataaaagtactgaaaaggaaatggttgatttttgatgtaggcttt
ggatatacggagattataggagacggagtaatcgggttaacaccggaaataggaacaaat
gaaaattttgcttatttctcgaatgtaatgcttcgttccggagtgggaaatatgagcgga
aaatacctggttaaaaaccttgagacgcaggaaacctttgaaatagatattccgaaattt
aatctgctatctgaagttctaagcaattga

DBGET integrated database retrieval system