KEGG   Coriobacterium glomerans: Corgl_0124Help
Entry
Corgl_0124        CDS       T01453                                 

Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
cgo  Coriobacterium glomerans
Pathway
cgo00627  Aminobenzoate degradation
cgo01100  Metabolic pathways
cgo01110  Biosynthesis of secondary metabolites
cgo01120  Microbial metabolism in diverse environments
cgo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cgo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Corgl_0124
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Corgl_0124
Enzymes [BR:cgo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     Corgl_0124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AEB06251
UniProt: F2N9Z6
Position
143001..143570
Genome map
AA seq 189 aa AA seqDB search
MMSSGARVVVGVSGASGAALALECLRCLAETEVESCLVLSSNAELTINQELGMSVEEFSG
HADRVFDNRNIGASIASGTFRTDGMIVAPCSMKTLSGVANGFSENLLLRAADVTLKEQRP
LVLMVRESPLSAIHVDNMAKLARIPGVVLMPPLLTFYNEPTSVDDMVHHIVCKALQVFDI
ECSGFHRWS
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcagcggcgcgcgcgtagttgtaggggtatcgggtgcaagcggggcggcgctc
gccttggagtgtctgaggtgcctcgctgagaccgaagtcgagagctgcctcgttctctcc
tcgaatgcagagctcacgatcaaccaggagctcggtatgagcgtcgaggagttctcagga
cacgccgatcgcgtcttcgacaaccggaacatcggcgcctcgatcgcgagcggcacattc
agaacggatggcatgatcgtggcgccttgctcgatgaagacgctgtccggggtcgccaac
ggtttctcggagaatctgctgctgcgggcagccgatgtcacgctcaaggaacagcgtccg
ctcgttctcatggtcagggaatctccgctgagcgcgatccatgtcgacaacatggccaag
ctcgcccgtattccgggtgtggttttgatgccgcccctgttgacattttataacgagcct
accagcgtggacgatatggtgcaccatatcgtctgcaaagctctgcaggtgttcgatatc
gagtgctcgggttttcatcgctggtcgtag

DBGET integrated database retrieval system