KEGG   Coriobacterium glomerans: Corgl_0728Help
Entry
Corgl_0728        CDS       T01453                                 

Definition
(GenBank) Fructose-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
cgo  Coriobacterium glomerans
Pathway
cgo00010  Glycolysis / Gluconeogenesis
cgo00030  Pentose phosphate pathway
cgo00051  Fructose and mannose metabolism
cgo00680  Methane metabolism
cgo01100  Metabolic pathways
cgo01110  Biosynthesis of secondary metabolites
cgo01120  Microbial metabolism in diverse environments
cgo01130  Biosynthesis of antibiotics
cgo01200  Carbon metabolism
Module
cgo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cgo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Corgl_0728
   00030 Pentose phosphate pathway
    Corgl_0728
   00051 Fructose and mannose metabolism
    Corgl_0728
  Energy metabolism
   00680 Methane metabolism
    Corgl_0728
Enzymes [BR:cgo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Corgl_0728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-ProteinID: AEB06842
UniProt: F2NBN3
Position
complement(858654..860555)
Genome map
AA seq 633 aa AA seqDB search
MVTAERSDQTRKYLKLLSQQFPNQQAVFTEIINLQAILNLPKGTEHFMSDLHGEYAAFMH
ILNNCSGVIREHVDEIFEDELSDAEKGDLCTLIYYPREKLSRVHEARLDSPTWYRTTLNR
LITITRALSSRYTRSKVRKAIPHDFAYIIDELLHTHPDENNYRVRYHERILDSILETASA
PDFIHSLAALIKRLAVDHLHLVGDIFDRGGGAADIIGRLMRYHSLDIQWGNHDILWMGAA
AGEPACIISVLRNNLRYNNYKILENDYGISLRELVYFADRTYRDAGRLTPLMKAVNVLLF
KLEGQIILRHPEFDMEDRLLLDKIDPVGGTVRIDGVEHTLSTRDFPTLDPEHPFELSFPE
QRIVERLVAEFTAADRLREHMNFLYTHGSIYLVNNNNLLFHGCVPMREDGTFTCMECDGV
WRSGRDYLDFCDAIARRAWSERDREALDWMWYLWIGFASPVSGRLVKTFERAYLEDPSTW
DEPMDPYFTLTRSQDACDAVMREFGVNPDSGHIINGHTPVKTMDGEKPIRAGGRLLVIDG
GFCRAYHPTTGIAGYTLISSSRGMRLKAHEAFKSVEAALEQNADIRSETDRFGDAERRIM
VSDTDTGKVIRDQISDLRQLLDAYRCGLLQARC
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atggtcacagcagagcgctccgatcagacgcgcaagtacctgaaactgctgtcacagcag
ttccccaaccagcaggcggtcttcacggagatcatcaacctccaggcgatcctgaacctg
ccgaagggaaccgagcacttcatgagcgatctgcatggggagtacgccgcgttcatgcac
atcctgaacaactgctccggtgtgatccgcgagcacgtcgacgagatcttcgaagatgag
ctctccgatgcggagaagggcgatctgtgcacgctgatctactacccgcgcgagaagctc
tcgcgcgtgcacgaggcccggctcgactcgcccacatggtacaggaccacgctcaaccgc
ctcatcaccatcacccgcgcgctttcgagccgctatacgcgctccaaggttcgaaaggcc
atcccgcatgatttcgcctacatcatcgatgagctgcttcacacgcatccagacgagaac
aactatcgcgtccggtaccacgagcgcatcttggactccatactcgagaccgcctctgcg
cccgatttcattcattcgctcgccgcgctgatcaagcgactggccgtagaccacctccat
ctggtcggcgatatcttcgatcgcggtggaggcgcggcggacatcatcgggcgcctcatg
cggtaccactcgctcgacatacaatggggcaaccacgatatcctatggatgggagcggct
gccggcgagcccgcatgcatcatctcggtgctgcgcaacaacctgcgctacaacaactac
aagatcctcgagaacgactacggaatctccctgcgcgagctcgtctacttcgctgatcgc
acctaccgcgacgccggccgtctgaccccgctcatgaaggcggtgaacgtgctgctgttc
aagctcgagggccagatcatcctgcgtcacccagagttcgacatggaagatcgtctgctt
ctcgacaagatcgatccggtcggcggcaccgtgcgcatcgacggggtcgagcataccttg
agcacacgcgacttcccgaccctcgatcccgagcatccctttgagctcagcttccccgag
cagcgcatcgtcgagaggctcgttgcggagttcacggcggcggaccggctccgcgagcac
atgaactttctttacactcacggatcgatctatctcgtcaataacaacaacctgctgttc
cacggctgcgtacccatgagagaagatgggacgttcacatgcatggagtgcgacggcgtg
tggagatcggggcgagattatctcgacttctgtgacgccatcgcccgtcgcgcctggtcc
gagcgcgaccgagaggcgctcgactggatgtggtatctctggatcggcttcgcatccccg
gtatccggccgactcgtgaagaccttcgagcgcgcctatctcgaagacccctcgacgtgg
gatgaaccgatggacccgtacttcacgctcacgcgctcccaggatgcctgcgacgccgtc
atgcgcgaattcggtgtgaacccggacagcggacatatcatcaacggtcacacgccggtg
aagaccatggacggagagaagccgatacgtgccggcgggcggttgctcgtcatcgacgga
gggttctgtcgcgcctatcatccgacgaccggtatcgcgggctacacgctcatctccagc
tcccgcggtatgcgcctcaaggcgcacgaagccttcaagagcgtcgaggccgcactcgag
cagaacgccgatatccggagcgagaccgatcgcttcggcgacgccgagcgccgcatcatg
gtgagcgacacggacaccggcaaggtgatacgagaccagatctcagaccttcgtcagctg
ctggatgcctaccgatgcggactgcttcaggctcgatgctag

DBGET integrated database retrieval system