KEGG   Corynebacterium glutamicum AR1: CGLAR1_02675Help
Entry
CGLAR1_02675      CDS       T03362                                 

Definition
(GenBank) 2,5-dioxovalerate dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
cgq  Corynebacterium glutamicum AR1
Pathway
cgq00040  Pentose and glucuronate interconversions
cgq00053  Ascorbate and aldarate metabolism
cgq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CGLAR1_02675
   00053 Ascorbate and aldarate metabolism
    CGLAR1_02675
Enzymes [BR:cgq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     CGLAR1_02675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DnaB_bind
Motif
Other DBs
NCBI-ProteinID: AIK84186
Position
complement(525944..527506)
Genome map
AA seq 520 aa AA seqDB search
MITATALHGCSLIDGEWVTGKNGEITGFDPRTNASLNPSYSLANSTQLRAATTSAKRAFE
SYRLTTPEVRADFLDSIADNIDALTEEIVQRASLETGLGTTRLTGEVARTSNQLRLFAET
VRAGKFHRVRIERGPRIDLRQRQVPLGPVAVFGASNFPLAFSTAGGDTASALAAGCPVVF
KAHNAHPGTAELVGQAVRGAVEKHEFDAGVFNLVYGRGVEIGQELAADPNITAIGFTGSR
QGGLALSQTAFSRPVPVPVFAEMSATNPVFVFPCALADLDASSSLAEAFTASVTGSSGQL
CTKPGLIFIPRGVAGDAFVALVAAKFKETTGQTMLTQGIAQAWQRGVDNLAAQPSVKILA
QGTPGDGENAPGPVVFESDVQALLNNAVLQEEIFGAASLLVRYDSPDQLHQVANSLEGQL
TATIHASQDDFQEVSKLIPLLEDLAGRVLYGGWPTGVEVGHTVIHGGPYPATSNAQSTSV
GTLAIERFMRPVSYQTFPAELLPDPVSEANKWAVPREIDS
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgattaccgcaaccgcactgcatgggtgttcactgattgatggcgagtgggtcactgga
aaaaatggtgagattacaggattcgatccgcgcaccaatgcgagcctgaacccttcctac
tctttagcaaacagcacacagctgcgcgccgccacaacatcggcgaagcgagcgtttgaa
agctaccgcctcactaccccagaggttagagcagatttcctggattccatcgctgacaac
atcgatgccttaaccgaagagatcgtgcaacgggcgagcctggagacaggtttgggaacc
acccgactcacaggcgaagtagcccgcaccagcaaccagctccgcctgtttgcagaaact
gtgagagccggaaagttccaccgagtacgcattgaacgaggaccgcggattgatcttcgc
cagcgtcaggtccctctgggaccagtcgcggtattcggggcaagcaacttccccctcgct
ttctctactgctggtggcgatacagcatcagcgttggctgcaggctgccctgtggttttt
aaggcgcataatgcgcaccctggaaccgctgagctcgtcgggcaagcggtgcggggagcc
gtcgaaaagcatgagtttgatgctggtgtgtttaaccttgtctacggccgtggcgtggaa
attggccaggagctggctgcggatccgaatatcacggcaatcggttttaccggttcacgc
cagggtggtttggcactgtcacagactgcgtttagccgcccagttcccgttccagtcttt
gcagaaatgagtgccaccaaccctgtgttcgtcttcccctgcgcgctggcggatttggat
gcatcgagttccttggctgaggcgtttaccgcttccgtcaccggcagttccgggcaattg
tgcaccaagcctggcctcattttcatcccgcgcggtgttgctggtgatgcttttgtggcg
ctcgtagcagccaaatttaaagaaaccacgggacaaaccatgctcacacaaggcattgcc
caggcgtggcagcgcggagtggacaaccttgcagcacaaccaagcgtaaaaatcctcgcc
caaggcacccccggagatggagagaacgcgccgggcccggtggtgtttgaaagcgatgtg
caggctttgttaaataatgcggtgttgcaggaggaaatcttcggcgcagcatctctgttg
gtgcgctacgattccccggatcaacttcaccaagtagccaattcactcgagggacaatta
acagccacgattcacgcatcccaggatgatttccaggaagtctcgaaacttatccccctc
ttggaggatctcgcgggccgtgttctttacggcggctggccaacgggtgtggaagttggg
cacacggttatccatggaggcccttatccggcgacctcaaatgcgcagtcgacaagtgtt
ggaaccctggcaatcgagagatttatgcgcccggtttcttatcaaactttcccggctgag
ctgcttccagatccagtttctgaggcgaataaatgggctgtacctcgggaaatagatagt
taa

DBGET integrated database retrieval system