KEGG   Corynebacterium glutamicum AR1: CGLAR1_06190Help
Entry
CGLAR1_06190      CDS       T03362                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cgq  Corynebacterium glutamicum AR1
Pathway
cgq00071  Fatty acid degradation
cgq00072  Synthesis and degradation of ketone bodies
cgq00280  Valine, leucine and isoleucine degradation
cgq00310  Lysine degradation
cgq00362  Benzoate degradation
cgq00380  Tryptophan metabolism
cgq00620  Pyruvate metabolism
cgq00630  Glyoxylate and dicarboxylate metabolism
cgq00640  Propanoate metabolism
cgq00650  Butanoate metabolism
cgq00900  Terpenoid backbone biosynthesis
cgq01100  Metabolic pathways
cgq01110  Biosynthesis of secondary metabolites
cgq01120  Microbial metabolism in diverse environments
cgq01130  Biosynthesis of antibiotics
cgq01200  Carbon metabolism
cgq01212  Fatty acid metabolism
cgq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cgq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CGLAR1_06190
   00630 Glyoxylate and dicarboxylate metabolism
    CGLAR1_06190
   00640 Propanoate metabolism
    CGLAR1_06190
   00650 Butanoate metabolism
    CGLAR1_06190
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CGLAR1_06190
   00072 Synthesis and degradation of ketone bodies
    CGLAR1_06190
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CGLAR1_06190
   00310 Lysine degradation
    CGLAR1_06190
   00380 Tryptophan metabolism
    CGLAR1_06190
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CGLAR1_06190
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CGLAR1_06190
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CGLAR1_06190
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cgq04147]
    CGLAR1_06190
Enzymes [BR:cgq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CGLAR1_06190
Exosome [BR:cgq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CGLAR1_06190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Ketoacyl-synt_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIK84853
Position
1275465..1276631
Genome map
AA seq 388 aa AA seqDB search
MSVVVAGIGETPMGKYPDRSIYEMIREAGHAAIAEAGIDPNLITTAYVGNFNGQQLLGQG
HFGPLVMETLGLSHVPAMRVEGACVSGGLALLQGVEAIRSGRHKAVLVGGVEKMTHQTTA
AVTGALTSAMDIEFEAHSGLTFPGAFALVAHRYFHEYRNVQREMAQVAVNAHDNALLNPT
AQMHKAIDIEKVLNAPRIADPLGLYDCSLVTDGAAFMVLVSEELAAQLPDNGHRQVKIVG
SGHGGDALTLHGKDSMTTFGATVRAAKQAYAEAGVQASDIDLAEVHDCFTITQIINTEDL
GFFEKGHGGDAVAEGRTARTGDMPINVSGGLKAKGHPIGATGISQAFEVITQIRGGAGDR
QINQADTGLTHNLGGTAGTCVINIFRGA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcgttgtcgccggaattggcgaaacccccatgggaaagtacccggatcgcagc
atttatgaaatgatccgggaagcaggccacgcagcaattgctgaggcaggcattgatccc
aacctcatcaccacagcgtacgtgggtaatttcaatggacagcagctccttggtcaggga
cacttcggcccactggtgatggaaactttgggactttcccatgtgccagccatgcgcgtg
gaaggcgcatgcgtttctggtggtctggcgttgcttcaaggcgttgaggcaattcgctcc
ggccgacacaaagcagtgctggttggtggcgtggagaagatgactcaccaaacaactgct
gcagtcaccggcgctttgacctctgcgatggacattgagttcgaggctcattctggcctc
actttcccaggcgctttcgcactggtggctcaccgttacttccatgagtaccgcaatgtg
cagcgcgaaatggcgcaggttgcagtcaatgctcatgacaatgcactgctcaatccgaca
gcgcagatgcataaggctattgatatcgaaaaagtgctaaatgcgccaagaattgctgat
ccactgggtctctatgattgctcactggtcaccgatggtgccgcatttatggtgttagtg
tctgaagaactggcagcgcagctccccgacaacggacaccgccaagttaaaatcgtcggc
tccggtcacggcggtgatgccttgaccctgcacggcaaagattccatgaccacttttggt
gcaactgttcgcgccgcgaagcaagcctatgccgaggcgggtgtccaggcctccgatatt
gatttggcggaagtccacgattgtttcaccattacccaaatcatcaacaccgaggatctc
ggattctttgaaaaaggtcacggtggcgacgctgttgcagaaggccgaactgcccgaacc
ggcgacatgccaatcaacgtctctggtggattgaaagccaagggtcatcccattggcgct
accggaatcagccaagcttttgaagtgatcactcaaatcaggggcggggcaggggaccga
caaatcaaccaagccgatacgggattgacccacaacctgggtggaaccgccggtacctgc
gtgatcaacattttccgaggagcataa

DBGET integrated database retrieval system