KEGG   Candida glabrata: CAGL0B04785g
Entry
CAGL0B04785g      CDS       T01024                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11364  SAGA-associated factor 29
Organism
cgr  Candida glabrata
Brite
KEGG Orthology (KO) [BR:cgr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cgr03021]
    CAGL0B04785g
   03036 Chromosome and associated proteins [BR:cgr03036]
    CAGL0B04785g
Transcription machinery [BR:cgr03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     CAGL0B04785g
Chromosome and associated proteins [BR:cgr03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    SAGA complex
     CAGL0B04785g
    SLIK complex
     CAGL0B04785g
    ADA-HAT complex
     CAGL0B04785g
    ATAC complex
     CAGL0B04785g
SSDB
Motif
Pfam: DUF1325 Agenet Tudor_3 PilZ DUF4537
Other DBs
NCBI-GeneID: 2886654
NCBI-ProteinID: XP_445178
UniProt: Q6FXL7
Position
B:459394..460194
AA seq 266 aa
MDGQWDLVISSLQDIYNANEVTAFDEDMEMKKLNFENLELAQLDEYFDKFQEHKENIRRA
HRLLETVRTNLATVIENTEPSQSAAGTPGPNHSEEVTPGGSGAAANAVATGPLGKLYWIS
QFCSNEPIYLHSEVAYKPKKGNIDGEWFQCEVVKISSDGMRFEVMDPEPDEQGKTGKVFK
CSWKDLLLIPPETTPRSKIPNYPPGTQVLARYPETTTFYPAVVIGNKRDGTCRLRFDGEE
DAEKETEVPRRLVLPSPMISAFPTKK
NT seq 801 nt   +upstreamnt  +downstreamnt
atggacgggcagtgggacttagttatatcgtcgctgcaggatatatacaatgcgaacgag
gtgacggcgttcgatgaggacatggagatgaagaagcttaacttcgagaatttggaactc
gctcaattggatgagtactttgacaagttccaagagcacaaggagaacattagaagagca
cataggctattggagacagtgcgcactaacttggctaccgtgatcgaaaacaccgaacca
agccagtcggcagcaggtacacctgggcctaaccatagtgaagaggtaactcctggtggt
tctggtgctgcagctaatgcagttgctactggtcctctgggcaagctgtactggatcagt
caattttgttcaaacgaacctatctatctgcactctgaggtcgcgtataagcccaaaaag
ggaaacatcgatggcgagtggtttcaatgtgaagtggtcaagatctccagtgatgggatg
aggtttgaagtcatggaccctgagcccgatgagcaaggtaagactggcaaggtgttcaag
tgctcgtggaaggatttgttgttgatcccaccggagactactccaagatccaaaatacct
aactatccaccaggtactcaggtgctagcaagatatcctgaaaccactactttttaccca
gctgtggtaattggaaacaagcgagacggtacttgtagattacgtttcgatggcgaagaa
gatgccgagaaggaaactgaggtgcctagaagactcgtcttaccttctccaatgatctca
gcattcccaacaaaaaaatga

DBGET integrated database retrieval system