KEGG   Candida glabrata: CAGL0C02849g
Entry
CAGL0C02849g      CDS       T01024                                 

Definition
(RefSeq) uncharacterized protein
  KO
K17292  tubulin-specific chaperone A
Organism
cgr  Candida glabrata
Brite
KEGG Orthology (KO) [BR:cgr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cgr04812]
    CAGL0C02849g
   04147 Exosome [BR:cgr04147]
    CAGL0C02849g
Cytoskeleton proteins [BR:cgr04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Others
     CAGL0C02849g
Exosome [BR:cgr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CAGL0C02849g
SSDB
Motif
Pfam: TBCA TPR_10 FapA
Other DBs
NCBI-GeneID: 2886896
NCBI-ProteinID: XP_445301
UniProt: A0A0W0EDZ0 Q6FWU3
Position
C:283844..284164
AA seq 106 aa
MSPTQLEIKVKALQRLVKEEKYYLQELKDQKKHVDELKADSSVDKYDLKKQEEVLADTER
LLPTLYVKIKEFQDNLEEYLNTYNGNEDTKEAKEAIETSKKLLSKH
NT seq 321 nt   +upstreamnt  +downstreamnt
atgtccccaacacaattagagataaaagtgaaagccttgcagagattggtcaaggaagaa
aagtactacttgcaagagctgaaggatcagaagaagcatgttgatgagctgaaggctgac
agttcagttgacaagtatgacctgaaaaagcaggaagaagtattggctgacactgaaaga
ttgctacccacattatacgttaaaataaaggagttccaggataacttggaagaatatctg
aacacatacaatggtaacgaggatacaaaagaagctaaggaagcaattgaaacttcgaag
aaacttctctctaagcactga

DBGET integrated database retrieval system