KEGG   Candida glabrata: CAGL0C05379gHelp
Entry
CAGL0C05379g      CDS       T01024                                 

Definition
(RefSeq) uncharacterized protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
cgr  Candida glabrata
Pathway
cgr03040  Spliceosome
cgr04141  Protein processing in endoplasmic reticulum
cgr04144  Endocytosis
cgr04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:cgr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    CAGL0C05379g
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CAGL0C05379g
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    CAGL0C05379g
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    CAGL0C05379g
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cgr01009]
    CAGL0C05379g
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cgr03041]
    CAGL0C05379g
   03009 Ribosome biogenesis [BR:cgr03009]
    CAGL0C05379g
   03110 Chaperones and folding catalysts [BR:cgr03110]
    CAGL0C05379g
   04131 Membrane trafficking [BR:cgr04131]
    CAGL0C05379g
   03051 Proteasome [BR:cgr03051]
    CAGL0C05379g
   03029 Mitochondrial biogenesis [BR:cgr03029]
    CAGL0C05379g
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cgr04147]
    CAGL0C05379g
Protein phosphatases and associated proteins [BR:cgr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     CAGL0C05379g
Spliceosome [BR:cgr03041]
 Complex B
  Other components
   Prp19 complex
    CAGL0C05379g
 Complex C
   Prp19-CDC5 complex
    CAGL0C05379g
Ribosome biogenesis [BR:cgr03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    CAGL0C05379g
Chaperones and folding catalysts [BR:cgr03110]
 Heat shock proteins
  HSP70 / DNAK
   CAGL0C05379g
Membrane trafficking [BR:cgr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    CAGL0C05379g
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    CAGL0C05379g
Proteasome [BR:cgr03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    CAGL0C05379g
Mitochondrial biogenesis [BR:cgr03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    CAGL0C05379g
Exosome [BR:cgr04147]
 Exosomal proteins
  Proteins found in most exosomes
   CAGL0C05379g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C
Motif
Other DBs
NCBI-GeneID: 2886843
NCBI-ProteinID: XP_445408
UniProt: Q876N3
Position
C:complement(512277..514118)
Genome map
AA seq 613 aa AA seqDB search
MADGVFQGAIGIDLGTTYSCVATYESSVEIIANEQGNRVTPSFVAFTPEERLIGDAAKNQ
AALNPKNTVFDAKRLIGRRFDEESVQNDMKTWPFKVVDVDGAPVIEVEYLGENKQFSPQE
ISSMVLTKMKEIAEAKIGKKVEKAVITVPAYFNDAQRQATKDAGAISGLNVLRIINEPTA
AAIAYGLGAGKSDKERHVLIFDLGGGTFDVSLLHIAGGVYTVKSTSGNTHLGGQDFDTNL
LEHFKGEFKKKTGLDISNDARALRRLRTAAERAKRTLSSVTQTTVEVDSLFEGEDFEASL
TRARFEDLNAALFKSTLEPVEQVLKDAKISKSQIDEVVLVGGSTRIPKVQKLLSDYFDGK
QLEKSINPDEAVAYGAAVQGAILTGQSTSDETKDLLLLDVAPLSLGVGMQGDIFGVVVPR
NTTVPTIKRRTFTTVGDNQTTVQFPVYQGERVNCKENTLLGEFDLKNIPPMPAGEPVLEA
IFEVDANGILKVTAVEKSTGKSANITISNAVGRLSSEDIEKMVNQAEEFKAADEAFAKRH
EAKQRLESYVASIEQTVTDPVLSSKLKRGSKTKIEAALADALSALQIEDGSAEEYRKAEV
GLKRVVTKAMSSR
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggctgacggtgttttccaaggtgctattggtatcgatttgggtactacttactcatgt
gttgctacatatgaatcctctgttgaaattattgccaacgagcaaggtaaccgtgttacc
ccatctttcgttgccttcactccagaagagagattgatcggtgatgccgctaagaaccag
gctgctttgaacccaaagaacaccgtcttcgacgccaagagattgatcggtcgtcgtttc
gacgaggagtctgtccagaacgacatgaagacctggcctttcaaggttgtcgatgtcgat
ggtgctccagttatcgaagtcgaatacttgggtgagaacaagcaattctccccacaagaa
atctcctccatggtcttgaccaagatgaaggaaatcgctgaggctaagatcggtaagaag
gtcgaaaaggctgtcatcaccgtcccagcttatttcaatgacgctcaaagacaagctacc
aaggatgctggtgccatctctggtctaaacgtcttgcgtatcatcaacgaacctaccgcc
gctgccatcgcttacggtctaggtgccggtaagtctgacaaggaaagacacgtcctgatc
ttcgatttgggtggtggtactttcgatgtctctttgttgcacattgctggcggtgtctac
actgtcaagtccacctccggtaacactcacttgggtggtcaagatttcgacaccaacttg
ttggaacacttcaagggtgaattcaagaagaagactggtttggacatctccaacgatgcc
agagctttgagaagactaagaactgctgctgaaagagctaagagaactttgtcctccgtc
acccaaaccaccgtcgaagtcgactccttgttcgaaggtgaagacttcgaagcctctttg
accagagctagattcgaagacttgaacgccgctttgttcaagtccactttggaaccagtt
gaacaagtcttgaaggatgctaagatctctaagtctcaaatcgacgaagtcgttttggtc
ggtggttctaccagaattccaaaggtccaaaagctattgtctgactacttcgacggtaag
caattggaaaagtctatcaacccagatgaagccgtcgcttacggtgccgctgttcaaggt
gctatcttgaccggtcaatccacctccgacgaaaccaaggacctattgttgttggatgtc
gctccattgtctttgggtgttggtatgcaaggtgacatcttcggtgtcgttgtcccaaga
aacaccactgtcccaaccatcaagagaagaactttcaccactgtcggtgacaaccaaacc
accgttcaattcccagtttaccaaggtgaacgtgttaactgtaaggaaaacactttgttg
ggtgaattcgacttgaagaacatcccaccaatgccagctggtgagccagtcttggaagct
atcttcgaagtcgatgccaacggtatcttgaaggtcactgccgttgaaaagtccactggt
aagtccgctaacattaccatctccaacgctgttggtagattgtcttctgaagacattgaa
aagatggttaaccaagccgaagaattcaaggctgctgacgaagctttcgccaagagacac
gaagctaagcaaagattggaatcttacgttgcttccatcgaacaaaccgtcactgaccca
gtcttgtcttccaagttgaagagaggttctaagactaagattgaagctgctttggctgac
gctttgagtgctctacaaatcgaagatggtagcgctgaagaatacagaaaggctgaagtt
ggtttgaagagagttgtcaccaaggctatgtcttcccgttaa

DBGET integrated database retrieval system