KEGG   Candida glabrata: CAGL0E06336gHelp
Entry
CAGL0E06336g      CDS       T01024                                 

Definition
(RefSeq) hypothetical protein
  KO
K12272  signal recognition particle receptor subunit beta
Organism
cgr  Candida glabrata
Pathway
cgr03060  Protein export
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    CAGL0E06336g
Secretion system [BR:cgr02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   CAGL0E06336g
GTP-binding proteins [BR:cgr04031]
 Small (Monomeric) G-proteins
  Unclassified
   CAGL0E06336g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SRPRB Arf MMR_HSR1 Gtr1_RagA GTP_EFTU FeoB_N Roc RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 2887383
NCBI-ProteinID: XP_445965
UniProt: Q6FUX9
Position
E:637212..637976
Genome map
AA seq 254 aa AA seqDB search
MVASSLMIALVLVILTTLLIAFQVKKTLVSGHKSSQSSSYVKKVPTIIIAGPSYSGKTSL
FHKLTSDETNAKLLTVMSQEPSFALKYKGTMTTLADYPGHVKLAYKLKNGIIDLKGNLKG
ILFVLDSTIDPKNITETAEYLTEILLILEKIREPIDILIACNKNESFTARQPLKIKEALE
NEITRIFERKKKSLGNIERDIGDVDEINENLDLSFDISKGFKFDYLEGNVEVLAGSVHKN
KITTWQEWVGSHLV
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggttgcgtcaagtttaatgattgcattagtccttgtgatactaactacattactgata
gccttccaagtcaaaaagacattggtaagtggtcacaagagtagtcaaagtagcagttac
gtgaaaaaggttcctaccataataattgctggacctagttattccggtaagacaagcttg
ttccataaattaactagtgatgaaacaaacgctaagttattaacggtcatgtctcaagag
ccgtcatttgcattaaaatataaaggaactatgacaactctggctgattatcctggtcat
gttaagttggcatataagttgaaaaatggtataatagacttgaaaggtaatttgaaaggt
attttgtttgttctagacagtacaatcgatcctaagaatataactgaaacagcagagtac
cttaccgaaattttgctaatattggaaaaaattcgggagccaattgatatattaatagcc
tgtaacaagaatgaatcattcacagcaagacagccattgaaaatcaaagaagccttagaa
aatgagattactaggatatttgaaaggaaaaaaaaatctctcggtaatatagaacgtgat
attggtgacgttgatgaaataaacgaaaacttggatctatccttcgatatttcaaagggg
tttaagtttgactacctcgagggaaatgttgaagtattggcgggaagcgtacataagaat
aaaattacaacatggcaggagtgggttggaagtcatctggtttga

DBGET integrated database retrieval system