KEGG   Candida glabrata: CAGL0E06358gHelp
Entry
CAGL0E06358g      CDS       T01024                                 

Definition
(RefSeq) hypothetical protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cgr  Candida glabrata
Pathway
cgr00010  Glycolysis / Gluconeogenesis
cgr00260  Glycine, serine and threonine metabolism
cgr00680  Methane metabolism
cgr01100  Metabolic pathways
cgr01110  Biosynthesis of secondary metabolites
cgr01130  Biosynthesis of antibiotics
cgr01200  Carbon metabolism
cgr01230  Biosynthesis of amino acids
Module
cgr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cgr_M00002  Glycolysis, core module involving three-carbon compounds
cgr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAGL0E06358g
  09102 Energy metabolism
   00680 Methane metabolism
    CAGL0E06358g
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CAGL0E06358g
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cgr04131]
    CAGL0E06358g
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cgr04147]
    CAGL0E06358g
Enzymes [BR:cgr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CAGL0E06358g
Membrane trafficking [BR:cgr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CAGL0E06358g
Exosome [BR:cgr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CAGL0E06358g
  Exosomal proteins of melanoma cells
   CAGL0E06358g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Tnp_22_dsRBD
Motif
Other DBs
NCBI-GeneID: 2887384
NCBI-ProteinID: XP_445966
UniProt: Q6FUX8
Position
E:complement(639077..639820)
Genome map
AA seq 247 aa AA seqDB search
MPKLVLVRHGQSEWNEKNLFTGWVDVRLSAKGEQEAARAGELLKEKNVHPDILYTSKLSR
AIQTANIALSKADRLWIPVKRSWRLNERHYGALQGKDKAETLETYGEEKFNTWRRSFDVP
PPVIEADSPYSQKNDERYRDVDPNVLPQTESLALVIDRLLPYWEDVIAKDLLAGKTVMIA
AHGNSLRGLVKHLEGISDADIAKLNIPTGIPLVFELDENLKPSKPSYYLDPEAAAAGAAA
VAAQGKK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagttagttctagttagacacggtcaatccgaatggaatgaaaagaacttgttt
accggttgggtcgacgttagattgtccgccaagggtgaacaagaagccgctagagccggt
gaattgttgaaggagaagaacgtccacccagacatcttgtacacttccaagctatccaga
gctatccaaaccgctaacattgctttgtccaaggctgacagattgtggatcccagtcaag
agatcctggagattgaacgaaagacactacggtgctttgcaaggtaaggacaaggctgaa
accttggaaacttacggtgaagagaagttcaacacctggagaagatccttcgatgtccca
cctccagtcatcgaagctgactccccatactctcaaaagaacgatgaaagatacagagac
gtcgacccaaatgtcttgccacaaactgaatctttggctttggtcattgacagattgttg
ccatactgggaagatgttatcgccaaggacttgttggctggtaagaccgttatgatcgcc
gctcacggtaactccttgagaggtttggtcaagcacttggaaggtatctccgatgctgac
attgccaagttgaacatcccaactggtattccattggtcttcgaattggacgaaaacttg
aagccatccaagccatcttactacttggacccagaagctgctgctgctggtgccgctgcc
gtcgctgctcaaggtaagaaataa

DBGET integrated database retrieval system