KEGG   Candida glabrata: CAGL0F00561gHelp
Entry
CAGL0F00561g      CDS       T01024                                 

Definition
(RefSeq) uncharacterized protein
  KO
K03000  DNA-directed RNA polymerase I subunit RPA12
Organism
cgr  Candida glabrata
Pathway
cgr03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:cgr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    CAGL0F00561g
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cgr03021]
    CAGL0F00561g
Transcription machinery [BR:cgr03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Pol I specific subunits
     CAGL0F00561g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TFIIS_C RNA_POL_M_15KD DZR Baculo_LEF5_C C1_1 Baculo_p48 zinc_ribbon_12 zf-C4_Topoisom Zn-ribbon_8 zinc_ribbon_2 zf-ribbon_3 DUF2072 Zn_Tnp_IS1595 zinc_ribbon_13
Motif
Other DBs
NCBI-GeneID: 2887783
NCBI-ProteinID: XP_445998
UniProt: Q6FUU6
Position
F:complement(58585..58971)
Genome map
AA seq 128 aa AA seqDB search
MSAVGSLIFCDDCGNLLDNPEDKINNSNVIECSQCQAEYAKSQFTNLKVVTSTSEDAFPS
SLRLKRSVVKTHLKRDELKDDGATIKEKCPKCGHDEMRYQTLQLRSADEGATVFYTCIKC
NYKYRTNN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgtcggttcccttatattctgtgatgattgtggtaatcttctagataaccca
gaggataagattaacaacagcaatgttatcgaatgctcacagtgtcaagcagagtacgca
aagtcccagtttaccaacttgaaagttgtcacatccacaagtgaggatgcattcccatca
tcattgagactgaaaagatcggtagtgaagacgcatttgaagagagatgaactaaaagac
gatggtgctactatcaaagaaaaatgtccaaagtgtggccacgatgagatgcgttaccaa
acgttgcagttacgttcggcagatgaaggtgctacagttttctacacctgtatcaaatgt
aactacaagtacagaaccaataactga

DBGET integrated database retrieval system