KEGG   Candida glabrata: CAGL0F03399gHelp
Entry
CAGL0F03399g      CDS       T01024                                 

Definition
(RefSeq) hypothetical protein
  KO
K19703  4-hydroxysphinganine ceramide fatty acyl 2-hydroxylase [EC:1.14.18.6]
Organism
cgr  Candida glabrata
Brite
KEGG Orthology (KO) [BR:cgr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CAGL0F03399g
Enzymes [BR:cgr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.6  4-hydroxysphinganine ceramide fatty acyl 2-hydroxylase
     CAGL0F03399g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_hydroxylase Cyt-b5 Anth_synt_I_N
Motif
Other DBs
NCBI-GeneID: 2887589
NCBI-ProteinID: XP_446117
UniProt: Q6FUH7
Position
F:complement(333955..335097)
Genome map
AA seq 380 aa AA seqDB search
MSVAADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDG
KHGTDISQMELTTLKFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNTFDSTTFVK
DLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGKGSAP
LFGNFLEAFTKTAWWVVPTVWGPVVLYFITTALMNMNNPLALFLFGLGIFVWTLIEYCLH
RFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVFAALP
YYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRKLKKYHLEHHYKNYQLGFGVTSWFW
DKVFGTYLGPDAPLSKMKYE
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcgctgctgactcgtccaagactctggagctgttcccacagagcgttctagct
aagcataactccaaggatgactgctgggtgtccacacatgagaggaagatctacgatgtt
tccaagtacttgaaagaccatcctgaagaagccgatgctgttcacaaggctctagatggt
aagcatggtactgatatctcccaaatggagttgactactttgaagttcgttaccgacgac
tacttggtcggctacttagccaccagtgatgaagagaagaagttgttgaccaacaagtct
cacaaggttgaagtcaagttgaacgctgacaacacctttgactccaccactttcgttaag
gatttgccaactgaagacaagctttccatcaccactgattatgaaagagattacaagaag
cacaagttcttggacttgaacaagcctttgttgaagcaaatcttgttcggtaactttacc
aaggatttctacttggatcagattcacagaccaagacattacggtaagggctctgcgcca
ttgttcggtaacttcttggaagctttcactaagaccgcatggtgggttgtcccaactgtt
tggggtcctgttgtcctgtacttcattaccaccgctctaatgaacatgaacaacccattg
gcattgttcttatttggtctaggtatcttcgtctggactttgatcgaatactgtctacac
agattcttgttccacttcgacgaatggctaccagaacacagcatgttcttcatgatccac
ttcttgctgcatggttgccaccactacttgccaatggatgcctacagattagttgttcca
cctgccttgttcgttgttctgtgtgctcctatctacaagctggtcttcgctgctctacca
tactactgggcttgtgctggtttcgcaggtggtatgcttggttacatctgctacgatctg
tgccactacttcttgcatcactctaagatgccacctttcatgcgtaagttgaagaagtac
cacttggaacaccactacaagaactaccaactaggtttcggtgtcacctcttggttctgg
gacaaggtcttcggcacttacctaggcccagacgctccactatctaagatgaagtacgag
taa

DBGET integrated database retrieval system