KEGG   Candida glabrata: CAGL0F08503gHelp
Entry
CAGL0F08503g      CDS       T01024                                 

Definition
(RefSeq) hypothetical protein
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
cgr  Candida glabrata
Pathway
cgr00790  Folate biosynthesis
cgr01100  Metabolic pathways
Module
cgr_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CAGL0F08503g
Enzymes [BR:cgr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CAGL0F08503g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-GeneID: 2887571
NCBI-ProteinID: XP_446338
UniProt: Q6FTV6
Position
F:complement(848954..849691)
Genome map
AA seq 245 aa AA seqDB search
MQQALNHRLSSMERTGTPLNTRPASPYTSIPTVASDGLSWPSKGARTRAHETEEEEKQRT
GRIADAVKVILEELGEDVTREGLLDTPQRYAKAMLFFTKGYQTNIMDDVINNAVFEEDHD
EMVIVRDIEIYSLCEHHLVPFFGKVHIGYIPNKKVIGLSKLARLAEMYARRLQVQERLTK
QIAMALSEILKPLGVAVVIEASHMCMVSRGVQKTGSSTMTSCMMGCFRSHKTREEFLTLL
GRRSI
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaagccttaaaccatagattaagcagcatggaaagaactggaactccattgaac
acaagaccagcatcgccttacacaagcataccaacagtagcctctgatggtctttcatgg
ccaagtaaaggtgctagaactagagcacatgaaaccgaagaagaagagaaacaacggact
ggcagaattgccgatgcggtgaaggttattcttgaagaattgggtgaagatgttaccaga
gaaggcttactggacacaccacagaggtatgccaaggccatgcttttctttaccaaaggt
tatcaaacgaatataatggacgatgtgatcaacaatgctgtattcgaagaagaccatgac
gaaatggtcattgtccgtgacattgaaatatactctctgtgtgaacaccacttagttcca
ttctttggcaaagtacacattggttacatcccaaacaagaaagtcatcggtctaagtaaa
cttgccagacttgctgagatgtatgcaagaagattacaagtacaggaaagattaaccaaa
cagattgcaatggctttgagtgagatactgaaaccacttggtgttgctgtggtgattgaa
gccagtcacatgtgtatggtctcaagaggtgtgcagaaaactggttcatctaccatgaca
tcctgcatgatggggtgtttcagatcacataaaacaagagaagagtttctaacattgttg
ggaagacgctcaatataa

DBGET integrated database retrieval system