KEGG   Candida glabrata: CAGL0G03223gHelp
Entry
CAGL0G03223g      CDS       T01024                                 

Definition
(RefSeq) uncharacterized protein
  KO
K02365  separase [EC:3.4.22.49]
Organism
cgr  Candida glabrata
Pathway
cgr04111  Cell cycle - yeast
cgr04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:cgr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    CAGL0G03223g
   04113 Meiosis - yeast
    CAGL0G03223g
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cgr01002]
    CAGL0G03223g
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cgr03036]
    CAGL0G03223g
Enzymes [BR:cgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     CAGL0G03223g
Peptidases [BR:cgr01002]
 Cysteine Peptidases
  Family C50: separase family
   CAGL0G03223g
Chromosome and associated proteins [BR:cgr03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Separase
    CAGL0G03223g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_C50 LisH_TPL DUF5617
Motif
Other DBs
NCBI-GeneID: 2888336
NCBI-ProteinID: XP_446503
UniProt: Q6FTE1
Position
G:complement(300119..304933)
Genome map
AA seq 1604 aa AA seqDB search
MVRFDNSLHEVDLNAQLGDEYKTLSHSLKRGVTHDNNCTHHLMHQYTVSNLSYAVSNLTV
SDEGSSSEIETTLSNTYSYYYRIHGLRVINLITKQHLLLIVKLINGNCLNSASRNIISLY
NNTNRNSISEIQQLLLCDYTKNNKEYLSSLKILVLQTLLKKHDVSESIISVIKLFAYDRK
LLLEDHKLKKNTVIKLILNYYSKFKEYRLLFGLKFLQYIAQFNFRYDEFIKNMTRDAFLQ
QLGRQKTSNNTLTSRYLSMFYFSYQMQYKSNNDQLFSSTSAEHVPEGFFNLQNVVTNLER
NERFFDKYMMSTKQLNDLINIIAEEGRVFEKELDEKSILLIQRILSIFQIKCYEISKPVL
KFLDKIIILLNSNVKYLSNDISPLIKLIESMIQFCTTNSLHKTFENTMAVAYNIALKTKN
SELLLLVSKFEFSRLLLNYKETEKIKPSDLNKFNVFLSATKEIRNRYKILQIFYHHTLFD
GKEHFNEVYAVCEYIAAIVKRKIGTLKWENLECKSEVMKGIIAGVTNDRYPNNECMEPCI
LLLQSSFFPEKVLTSEEYNDSSNQDGIVYDVFPLLKCNYLLNNDIAKGRTMYLVQVTKTF
CQFATKDNKVNYCSRIENDFIKKLLNYLSINGYHKLLLSVVGILEKRTEYYKTLSNDYIT
YKAHSCMRLKLKNRTKHVFDQFTNQKGEIKFDDEKDIYNHLIMSLLYASWEDSPELFTSS
NERVPKDIKEHILDFSTNDKSNLNKYFQKLIFNIKFANYYASLLNQKKCYSYAVEVSKKG
LKIGKSVLKIIEKLDLNDRLTVLNQLVSSYSNLIKIYTAVGLAKGAQYYCKEVTKLLPVF
DQPIFLFSVHVLLFEFYLENGDYDSALTHKKNANYVFDNLNAEHDIINTTSFLYINEEYD
KIQESLRLYFGYDLNDTDFFLSWKLKLGNICDECPTQYSNMNFFNKIVHINQRLVLEIDA
DPFLKSLNETILANLNCVSPGSLSNILDVGMISSNSTNRSSNMTPKRRPTSFKTNKHIVM
DILDEFFTTFNAMRQELTERNVILKVSDIYRLNYFYLISLLSVPESRKQLIEETITQLNE
LPSEITHTYESLLADKNCDIYGKTIFELESSNYEIMKSKNVTLNWEEQIGKDRLLDLCNI
TVEVICIDICKLTNTLIIRRISNLDSKNIMAKIPIDRNVSRDLDADSLTFQQASESLQKI
INDSNESVSKNVTETIKDKNDVRNWWKRRYDLDELLGNLIERIEKTWLNGLSGILNGLYC
DKDALLEFQSKITAILNQILPSRRNCCNRANFLQLDEWIISLLLDLDPSDLGFFTALEDV
IYFILDTLSHKGEENAYDEIDFGLLHVLLEEEIRKVRVNKKLFTKIEHTFLVVGPSCHTF
PWEIMKPLKGRSVTRVPSLTILSNLLSSIKGNLPVKIERTNDISMILNSNSDLVRTEKTF
KDIFERIQDSRAGSRLLVNQKPTEEEYMDYLTNSKVFLYVGHGGGEQYVRNCTIERCDKL
PPVFLMGCSSAATKLNGNLNPNCVAESYMYGNSVMVLGNLWDVTDKDIDKFSIEMLEKCN
LLDAKPNTVITGVPQAVADSRTVCHLKYLNGAAPVVYGLPVVFI
NT seq 4815 nt NT seq  +upstreamnt  +downstreamnt
atggtacgatttgataatagtctccatgaagttgacttgaatgcacagttaggtgatgag
tataaaactttatcccactcacttaaacggggagtgacacatgataataattgtacacac
catttaatgcaccaatatacagtatcaaatttatcttatgcagtctcaaaccttaccgtc
tccgatgaaggatcatcaagcgagatcgaaactaccttaagcaacacatacagctattat
taccgcatacatggtctccgagttattaatttaataacaaagcaacatcttttacttata
gtgaaattaatcaatggtaattgcttgaatagcgcatccaggaatatcatttcattatac
aataacacaaataggaattccatttcagagattcagcaattgcttctatgtgattataca
aaaaacaataaggaatacttatcctcattgaagatattagtgttacaaacattattaaaa
aagcatgatgtatctgagagcattattagtgtcataaagctgtttgcctacgatagaaag
cttttattggaggatcataaattaaagaagaatactgtaattaaattaatacttaactac
tactctaagttcaaggaatatcgtttgctttttggattgaagttcttgcagtatattgca
caatttaacttcagatatgatgagtttataaaaaacatgactagagatgctttcttacag
cagttaggaagacagaagacttcaaacaatactctcacatcaagatacttgagcatgttc
tatttcagttaccagatgcaatataaatcaaataatgatcaactattttctagtacatcg
gctgagcatgtgccagaaggatttttcaatttacagaatgtagttactaatttagagcgg
aatgaaaggttctttgacaagtatatgatgtctaccaagcaattaaatgaccttatcaac
attatcgctgaagagggaagagtctttgagaaagagcttgatgagaaaagcattttgttg
atacaaagaatattgtcaatttttcaaataaaatgctacgagatatcgaaaccagtcttg
aaatttttggataagataataatcttactgaatagcaatgtgaagtatttatctaacgat
atttctccccttataaaacttatcgagtccatgatacagttttgtacaacaaactctcta
cataaaacgtttgagaacaccatggctgtggcatataacattgcactgaaaacaaaaaat
tctgagttacttttactggtatctaaatttgaattttctaggttgttattgaattacaaa
gaaaccgaaaaaatcaaaccatctgatctgaataaattcaatgtatttctttctgcaact
aaagagattagaaacagatacaaaattttacaaattttttatcatcatactttattcgac
ggtaaagagcactttaatgaagtctacgcagtttgtgaatatatagccgctattgtcaaa
aggaaaatcgggactctaaagtgggaaaacctagaatgcaagtcagaagtaatgaaggga
ataattgccggagttacaaatgataggtacccaaataatgagtgtatggagccctgtatt
ttactacttcaatcgtcattcttccccgaaaaagtgcttacttcagaggagtataacgat
agtagtaatcaagatggcattgtgtatgacgtttttccgcttctgaaatgcaactatttg
ttaaataatgatatcgcaaagggaagaacaatgtatctggtgcaggtcactaaaacattt
tgtcagtttgctaccaaagataataaagttaattattgctccagaatcgagaacgatttt
atcaaaaagctgcttaactatctatcgataaatggctaccataaacttcttctatcagtt
gttggaattttagagaaaagaacagaatattacaaaactttatcaaatgattatatcact
tataaggctcattcgtgtatgcgtttgaaattaaagaataggacaaaacatgtttttgat
caatttactaatcaaaaaggagaaatcaaatttgatgacgagaaagatatttacaaccat
ttaattatgagtttgttgtacgcttcctgggaagattcacccgaactttttacttctagc
aatgaaagagtacccaaggatattaaggagcatattttggattttagtactaatgacaaa
tctaacctgaataaatactttcagaaacttattttcaatattaagtttgctaactattat
gccagcttgttaaaccaaaagaagtgctactcttatgcagtggaggtcagtaaaaaaggt
ctaaaaattggaaaatctgttctaaaaataattgaaaagctagatttaaatgacagatta
acagttttgaatcaattagtatcatcttattccaatttaattaaaatctacactgcagtg
ggtcttgcgaagggcgctcaatattactgtaaagaagttacaaaattactgccagttttt
gaccaacctatttttttattttcagtacatgttctcttatttgaattttatctagagaat
ggggattatgattctgcgttgacgcataagaaaaatgcaaactatgtctttgataatcta
aatgcagagcatgatattatcaatactaccagctttttatatattaatgaagaatatgat
aaaatccaggagtcactaagattgtacttcggttatgacctgaacgataccgactttttt
ttgagctggaaacttaagctcggtaacatctgtgatgaatgtccaacacaatatagtaat
atgaatttctttaacaagattgtacatatcaaccagagattagtactagagattgatgca
gatccatttttgaaaagtttgaatgaaacaattttagcaaatttgaattgtgtatcacca
gggagtttaagcaatattttggatgttgggatgatatcatcaaacagcacaaatcggtcc
tcgaacatgacacccaaacggagaccgacaagttttaaaactaataagcacattgtaatg
gatatactggacgagttctttacaacatttaacgctatgagacaagaactcactgaaaga
aacgtaattttaaaggtttctgatatctaccgactaaactatttttacctaatttcgtta
ctgtcagtaccagagtcgaggaagcaattaattgaagaaacaatcactcagttaaatgag
ttaccttcggaaataacacatacttatgaaagtttactggccgataaaaattgcgacata
tatggtaaaactatatttgaactcgaatcatcaaattatgagattatgaaatctaaaaat
gtaacgcttaactgggaagagcaaattggaaaagaccgtttactagatttgtgtaatatc
acagtggaagtaatatgcattgatatatgtaaactgactaatactctgataataagaaga
atttcaaatctggattcgaaaaatatcatggccaaaatacccatagatcgaaatgtttct
agggatttagatgcagattctttaacatttcaacaagcgtcagaaagtttacaaaagata
attaacgatagtaatgaaagtgtatccaaaaatgttactgaaactataaaagacaagaat
gatgtacgcaactggtggaaacgaaggtatgatttagatgaattacttggcaatctaatt
gagaggattgagaaaacatggctaaatgggttatctggtatattaaacggattgtattgt
gataaggatgcgctactagaatttcaatcaaagataaccgcaattttaaatcagatacta
cctagcaggagaaattgttgtaacagagcaaattttctacagctggatgagtggataatc
agtttattgttagatctagatcctagtgatcttggatttttcactgcacttgaagatgtc
atttattttattttggatactctatcacataaaggtgaagaaaatgcttatgatgaaata
gattttgggttactccatgtattattggaagaagagatcagaaaggttcgagtaaacaaa
aaattattcaccaaaatcgaacataccttcttagttgtgggacccagttgtcatacattc
ccttgggaaataatgaaaccactcaaaggtcgctcagttactagagtaccatcgcttact
atattatccaatttattgtctagcattaaaggaaatttacctgttaaaattgaaaggacg
aacgatatttcaatgatattgaatagcaatagcgaccttgttcggacagaaaagaccttc
aaggatatttttgaaaggattcaggatagtcgagctggatctcgacttttagtcaaccaa
aaaccaactgaggaagaatatatggactatttgactaattcaaaggtatttttgtatgta
ggacatggtgggggggagcaatacgttcgtaactgtacaatagaaaggtgtgacaagcta
cctccggtatttctaatgggttgttcttcagcagcgacaaagcttaatggaaatcttaat
ccaaactgtgtagcggaatcatacatgtatggtaactctgttatggtcttaggtaacctc
tgggatgttactgacaaagatattgacaagtttagtatcgagatgcttgagaaatgcaat
ttacttgatgcgaaaccaaacacagtgattactggggttccccaagcagttgctgattca
aggactgtatgccacttgaaatacttgaacggagctgctcctgttgtgtatggactgccg
gtagtatttatataa

DBGET integrated database retrieval system