KEGG   Candida glabrata: CAGL0I02970g
Entry
CAGL0I02970g      CDS       T01024                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
cgr  Candida glabrata
Pathway
cgr00100  Steroid biosynthesis
cgr01100  Metabolic pathways
cgr01110  Biosynthesis of secondary metabolites
Module
cgr_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:cgr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    CAGL0I02970g
Enzymes [BR:cgr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     CAGL0I02970g
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 2889143
NCBI-ProteinID: XP_447380
UniProt: A0A0W0CP80 Q6FQW4
Position
I:259776..261089
AA seq 437 aa
MLNPKTKHFEFNGVVGAVAISVGLPIFTVFLNQMVRPEYYIEGWFSNFNLDKVFSGLHSL
DYYFVDRWDLWVYYLTWYFVLAFLDVVLPGRVMEGVELRDGTKLKYKINGVALSTFMVVV
VAMRWQLTQGRVPELQFLYKNHVDICVIAILFSALLATYCYIASFVPLLINSPNGVGTNE
KILALGGNSGNPIYDWFIGRELNPRIGPLDLKMFSELRPGMLLWLLINLSCLHHHYLRTG
TFNDALVLVNLLQGFYIFDGVLNEEGVLTMMDITTDGFGFMLAFGDLALVPFTYSLQARY
LSVSPIELGLPRVIFIVGVMALGFYIFRSANKQKSDFRQGNLPHLKSIQTKRGTKLLADG
WWAKSQHINYFGDWLISLSWCLTTWFQTPLTYYYSLYFATLLLHRQQRDEHKCREKYGEN
WAEYEKQVPYKIIPYVY
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgttgaatcccaagactaagcatttcgagtttaacggtgtggtcggtgccgtggccatc
tccgtggggctgcctatattcacagtgttcctgaaccagatggtcagacccgagtactac
atcgagggctggttcagcaatttcaatctggataaggtgttcagcgggctgcactcgctg
gactactacttcgttgaccgctgggacctgtgggtgtactacttgacatggtacttcgtg
ctggcgttcctggacgtggtcttgcccggcagagtcatggaaggtgtcgagctaagagac
ggcactaagttgaagtacaagatcaacggtgtcgctctgtccactttcatggtcgtggtg
gtagctatgcgttggcaattgacccagggtagagtgcccgagttgcaattcctgtataag
aatcacgtggacatctgtgttatagccatcttattctccgcgctgctggctacttactgc
tacattgccagcttcgttcctctactgatcaactcaccaaatggcgtcggcactaatgag
aagatcctggctctaggtggtaactccggcaacccaatttacgattggtttatcggccgt
gagttgaaccctcgcatcggtccgctggatttgaagatgttcagtgagttgagaccaggt
atgctgctgtggttattgatcaacttgtcctgtctgcatcatcactacttgagaactggc
actttcaatgatgctttggtgctagtgaacttgttgcaaggcttctacatcttcgatggt
gtgttaaacgaagaaggtgtgctaacaatgatggatatcacaactgatggtttcgggttc
atgcttgccttcggtgatctggcattggtcccattcacttattctctgcaagccagatat
ttgtctgtctcgcctattgaattgggtcttccaagagttatcttcattgttggcgtgatg
gccctaggtttctacatcttccgtagcgccaacaagcagaagtctgacttcagacaaggt
aacctaccacacttgaagagtattcagactaagagaggcacaaagcttcttgcggacggc
tggtgggcaaaatctcagcacatcaactacttcggggactggttgatctccttgagttgg
tgtctaaccacctggttccaaactcctttgacgtactactactccctatacttcgctact
ttgctgctgcatagacaacaaagagatgagcataaatgtagagagaagtacggtgagaac
tgggcagagtacgaaaagcaagtgccatacaagataatcccatatgtgtattaa

DBGET integrated database retrieval system