KEGG   Candida glabrata: CAGL0I07139gHelp
Entry
CAGL0I07139g      CDS       T01024                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
cgr  Candida glabrata
Pathway
cgr00020  Citrate cycle (TCA cycle)
cgr00640  Propanoate metabolism
cgr01100  Metabolic pathways
cgr01110  Biosynthesis of secondary metabolites
cgr01130  Biosynthesis of antibiotics
cgr01200  Carbon metabolism
Module
cgr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cgr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CAGL0I07139g
   00640 Propanoate metabolism
    CAGL0I07139g
Enzymes [BR:cgr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     CAGL0I07139g
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CAGL0I07139g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 2889188
NCBI-ProteinID: XP_447560
UniProt: Q6FQD4
Position
I:complement(685176..686135)
Genome map
AA seq 319 aa AA seqDB search
MLRFTRGFSRKAGVYDQTIKNLLLPKDTKVMFQGFTGKQGTFHAKISQEYGTNVVGGTNP
KKAGQTHLGQPVFASVKDCVKETGATVSGIFVPPPIAGAAIQEAIEAEIPLAVCITEGIP
QHDLLYISEMLKSQNKTRLVGPNCPGVINPANHVRVGIQPTRIFKPGKIGIVSRSGTLTY
EAVQQTTLSGLGQSLVVGIGGDAFPGTDFIDVLKLFLEDPQTEGIIMLGEIGGKPEIEAA
EFLQEYNFSKANPKPVASFIAGKVAGQMKGVRMGHSGAIVEGSGTDAESKKEALRNVGVQ
VVESPGYLGQTLLEQFSKL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgttgagatttactagggggttttctcggaaagcgggtgtttatgaccagacgatcaag
aatctactgttgcccaaggacacgaaggtgatgttccaagggtttacaggtaagcaaggt
acgtttcatgcgaagatctcgcaggagtacgggactaatgttgttggtggtactaatccg
aagaaggctgggcagacgcatctgggccagcctgtgtttgcgtcagtcaaggactgtgtg
aaggagacaggggccactgtgtccggtatatttgttccgcctccaattgcgggtgcggcc
atccaggaggccatcgaggcggagatcccattggcagtgtgtatcacggagggtattcca
cagcacgatttgctgtacatatctgagatgctgaagtcgcagaacaagaccaggctggtg
gggcccaattgcccaggtgtgatcaaccctgcgaaccacgtcagggtcggtatccagccc
acacgtatcttcaagccaggtaagattggtatcgtgtcgcgttcaggtactctgacttat
gaggccgtgcagcagactactctcagcggtctcggacagtccctcgtcgtgggtatcggc
ggtgacgcgttcccaggtaccgactttatagacgttctaaagctgttcctagaggaccca
cagacagaaggtatcatcatgctcggtgagatcggtggtaagccggaaattgaggccgca
gagttcttgcaggagtacaacttcagcaaagctaaccctaaaccagtcgcttccttcatt
gctggtaaagtagcaggacaaatgaagggtgttcgtatgggccacagtggtgctatcgta
gaaggtagcggaactgacgcagagtccaagaaagaagccctaagaaacgtgggtgtccaa
gtcgtcgaatccccaggttacttgggtcaaaccttgctagaacagttctctaagttgtaa

DBGET integrated database retrieval system