KEGG   Candida glabrata: CAGL0I07843gHelp
Entry
CAGL0I07843g      CDS       T01024                                 

Definition
(RefSeq) hypothetical protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cgr  Candida glabrata
Pathway
cgr00010  Glycolysis / Gluconeogenesis
cgr00071  Fatty acid degradation
cgr00350  Tyrosine metabolism
cgr01100  Metabolic pathways
cgr01110  Biosynthesis of secondary metabolites
cgr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAGL0I07843g
  Lipid metabolism
   00071 Fatty acid degradation
    CAGL0I07843g
  Amino acid metabolism
   00350 Tyrosine metabolism
    CAGL0I07843g
Enzymes [BR:cgr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CAGL0I07843g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Epimerase
Motif
Other DBs
NCBI-GeneID: 2889230
NCBI-ProteinID: XP_447590
UniProt: Q6FQA4
Position
I:complement(756345..757403)
Genome map
AA seq 352 aa AA seqDB search
MATLHAVPETQKGVIFYENNGKLEYKDIPVPKPKANEILINVKYSGVCHTDLHAWHGDWP
LATKLPLVGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCEKSNESNCPEAD
LSGYTHDGSFQQYATADYVQAARIPQGTDLAQVAPILCAGITVYKALKSANLNAGEWVAI
SGAAGGLGSLAVQYAKAMGYRILGIDGGDEKKALFHELGGEIFVDFTKSKNVEQDILVAT
NGGAHGVINVSVSEAAIESSTRYVRSNGTVVLVGLPANAKCSSDVFNHVVKSISIVGSYV
GNRADTREALDFFSRGLVKSPIKIAGLSELPEIYEKMEKGQIVGRYVVDTSK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggctactctacacgctgtcccagaaacccaaaagggtgttatcttctacgaaaacaac
ggtaagttggaatacaaggacatcccagtcccaaagccaaaggctaacgagatcttgatc
aacgtcaagtactctggtgtctgtcacactgacttgcacgcttggcacggtgactggcca
ttggctaccaagttgccattggtcggtggtcacgaaggtgccggtgtcgttgtcggcatg
ggtgaaaacgtcaagggctggaagatcggtgactacgctggtatcaagtggttgaacggt
tcctgtatggcctgtgaatactgtgaaaagtccaacgaatccaactgtccagaagctgac
ttgtctggttacacccacgacggttctttccaacaatacgctactgctgactacgtccaa
gctgctagaatcccacaaggtaccgacttggctcaagtcgctccaatcttgtgtgccggt
atcaccgtctacaaggctttgaagtccgctaacttgaacgccggtgaatgggttgccatc
tccggtgctgctggtggtctaggttctctagctgtccaatacgccaaggctatgggttac
agaatcttgggtatcgacggtggtgacgaaaagaaggctttgttccacgaattgggtggt
gaaatcttcgtcgacttcaccaagtccaagaacgtcgaacaagacatcttggttgctacc
aacggtggtgctcacggtgttatcaacgtctccgtctctgaagctgctatcgaatcctcc
accagatacgttagatccaacggtaccgtcgtcttggtcggtttgccagctaacgctaag
tgttcctctgacgtcttcaaccacgtcgtcaagtccatctccatcgtcggttcttacgtc
ggtaacagagctgacaccagagaagctttggacttcttctccagaggtttggtcaagtct
ccaatcaagatcgctggtctatctgaattgccagaaatctacgaaaagatggaaaagggt
caaatcgtcggtagatacgttgttgacacttccaaataa

DBGET integrated database retrieval system