KEGG   Candida glabrata: CAGL0K05115gHelp
Entry
CAGL0K05115g      CDS       T01024                                 

Definition
(RefSeq) hypothetical protein
  KO
K06634  cyclin H
Organism
cgr  Candida glabrata
Pathway
cgr03022  Basal transcription factors
cgr03420  Nucleotide excision repair
Module
cgr_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    CAGL0K05115g
  Replication and repair
   03420 Nucleotide excision repair
    CAGL0K05115g
Transcription machinery [BR:cgr03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CAGL0K05115g
DNA repair and recombination proteins [BR:cgr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     CAGL0K05115g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cyclin_C_2 Cyclin_N TFIIB SK_channel
Motif
Other DBs
NCBI-GeneID: 2890506
NCBI-ProteinID: XP_448449
UniProt: Q6FMU5
Position
K:complement(498091..499194)
Genome map
AA seq 367 aa AA seqDB search
MSESGVSTQSPQNSSTPDAKPVEHPPNYKRLTDDDLYRHSSQFRLWSFTPDKLLQKRTET
NARAVVVIEEKLRAFKEKHKDELTPDVAKVIDSKATPITTEEELKLVNFYAQKVQVIAQK
MSLPTEVVATSISFFRRFFLENSVLEVEPKDIVHTTIFLACKSENYFISVNSFAEKAKAT
KETILKYEFKLLETLKFTLMNHHPYKPLHGFFLDIQKTLHGKIDLKYMGKIYEKCKKRIT
EALLTDAVYFYTPPQITLATLMIEDEALTTRYLELKFHGQDAQTTDNTTDKSHSIHHINF
ERLLSVVQSCKEILEKPITISVQEAKGIMAKIYYCENPEGLLNRLKREPPKDSEDSPAKK
QKVLPPQ
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagtctggtgtgtctacgcagagtccacaaaattcttcaacgcctgatgcgaag
ccagttgagcatccacctaattacaagaggttaactgatgatgatctatatagacactcc
tcacaattcaggttatggtcgtttacacctgacaagttgttacagaaacgtacagagacg
aatgctagggctgtggttgttatagaagagaagcttagggcattcaaggagaaacacaag
gatgagttaacgcctgatgtagcgaaagtgatagatagcaaagccacaccgattaccacg
gaggaagaactcaaactggtaaacttctatgcgcaaaaagtacaagtcattgctcagaag
atgagcttacccactgaagtggtagccacctcaatttcattttttaggagattctttttg
gaaaactcagtattagaggttgagccaaaggacattgtacataccacaatttttctggct
tgcaaatcagagaactatttcataagtgtgaattcatttgcggagaaggcaaaggcaaca
aaggagaccatactgaaatatgaattcaaactcttagaaacgctaaagttcacgttaatg
aaccaccacccatataaaccattacatggtttctttttagatatccagaagacgttacat
ggcaagatcgacttgaagtacatgggtaagatttacgaaaaatgtaagaagagaataacg
gaagctctactgactgatgctgtttatttctatactccaccacaaataacgttagcaact
ctaatgatagaagatgaggctttaacaacaagatacttagaactgaaattccatggacag
gacgctcaaacgactgataatactactgacaagtctcacagcattcatcacattaatttt
gagaggctcttaagtgtagttcaatcatgtaaggaaatcctggagaaaccaattactatt
agcgtgcaggaggcaaagggaattatggcaaagatatactactgtgaaaacccagaaggg
ctactaaacaggttgaaacgagaaccacccaaggattcggaagattcaccagcaaaaaag
caaaaggtgttgccgccccagtga

DBGET integrated database retrieval system