KEGG   Candida glabrata: CAGL0K06281gHelp
Entry
CAGL0K06281g      CDS       T01024                                 

Definition
(RefSeq) hypothetical protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cgr  Candida glabrata
Pathway
cgr00230  Purine metabolism
cgr01100  Metabolic pathways
Module
cgr_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CAGL0K06281g
Enzymes [BR:cgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CAGL0K06281g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 MMR_HSR1 RNA_helicase AAA_22 AAA_18 AAA_28 AAA_24 NACHT ABC_tran AAA_29 AAA AAA_14 T2SSE RsgA_GTPase AAA_19 AAA_30 DUF2075 NTPase_1 Viral_helicase1 AAA_2 ATPase_2 cobW Adeno_IVa2 Rad17 Cytidylate_kin KAP_NTPase AAA_5 MobB dNK AAA_23
Motif
Other DBs
NCBI-GeneID: 2890461
NCBI-ProteinID: XP_448496
UniProt: Q6FMP8
Position
K:complement(609816..610373)
Genome map
AA seq 185 aa AA seqDB search
MSRPIVISGPSGTGKSTLLKKLFAEFPDTFGFSVSSTTRSPRPGEVHGKDYNFVTVDEFK
SMIDGEKFIEWAQFSGNYYGTTVDSVKAVISSGKTCILDIDMQGVKAVKTKDLNARFLFV
APPSMDDLKARLQGRGTETDESLQKRLAAADAEMEYANSGAHDKIIVNDDLDKAYNELKQ
FIFEN
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtccaattgtcatctctggtccaagtggtactggtaagtccactctattaaag
aagctatttgctgaattcccagacactttcggtttcagtgtctcgtctacaacacgttct
ccaagaccaggtgaggtacatggcaaggactacaactttgtcactgttgatgagttcaaa
tcaatgatcgacggcgagaagttcatcgaatgggcccaattctctggtaactactatggt
actaccgtggactccgttaaggctgtcatcagttctggcaagacctgtatcctagatatc
gatatgcaaggtgtcaaagctgtcaagaccaaggaccttaacgctagatttttgttcgtt
gccccaccatccatggacgacctaaaggctaggttgcaaggcagaggtaccgagacagac
gaatccttacaaaagagactggccgctgctgatgcagagatggaatacgctaacagcggt
gctcacgacaaaatcattgtcaatgatgaccttgacaaggcttacaacgaattgaagcaa
ttcatcttcgagaactaa

DBGET integrated database retrieval system