KEGG   Candida glabrata: CAGL0K08514g
Entry
CAGL0K08514g      CDS       T01024                                 
Name
(RefSeq) uncharacterized protein
  KO
K02515  serine/threonine-protein kinase HSL1, negative regulator of Swe1 kinase [EC:2.7.11.-]
Organism
cgr  Candida glabrata
Pathway
cgr04011  MAPK signaling pathway - yeast
cgr04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:cgr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    CAGL0K08514g
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    CAGL0K08514g
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cgr01001]
    CAGL0K08514g
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cgr04812]
    CAGL0K08514g
Enzymes [BR:cgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.-
     CAGL0K08514g
Protein kinases [BR:cgr01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   CAGL0K08514g
Cytoskeleton proteins [BR:cgr04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    CAGL0K08514g
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo
Other DBs
NCBI-GeneID: 2890318
NCBI-ProteinID: XP_448591
UniProt: Q6FMF3
Position
K:complement(854143..858612)
AA seq 1489 aa
MSVLIPHQQQRLRASSAAKKAAWNAMNKTVNIVSPHNNVNYVKKPSPKTNSNHLDRVIKS
VNDATKRLSEAESINSNNTKSSKRKSRDTVGPWKLGKTLGKGSSGRVRLAKNIENGTLAA
IKIVPKRTYNRRMRDQKMKTAGGVSSGTDSKDSSNREDPIKNGTDSALNPYGIEREIVIM
KLISHPNVMGLLEVWENKSELYLVLEYVDGGELFDYLVSKGKLSEPEAVHYFTQIIQGVS
YCHSFNICHRDLKPENLLLDKKNKVIKIADFGMAALELPNKLLETSCGSPHYASPEIVMG
KPYHGGPSDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGRFQLPPYLTNDAKDLITR
ILVTNPEKRLTINEILNHPLIKKYRNPPAHIRKLNLLGRGKSNSDLHVLEYNTPATVCLN
SEEDIDQSILKSLQILWHGTPRQRLVERLLVEGATEEKLFYSLLFQYKLKHSKPISATKL
QKKIEDVVLENESTKTESKDSSNEPGIDNNNDTSDFTQDGNSSEMVNELHTSAPMLEQKS
QFSQHSLKSKETVPISDLPPLPPVIPTFAASSSKAFRRSKSNLSSYLKRPKLENARSRTS
LFNSSSNTSITSSSISELNTRPRGNIPLSPSNITLTSLVSSRSLHNSASKKSLKNLQKRT
LQNSESKRSLYSQTSISKRSLNLNDYLIGGPSNSAELPPLPKLDSNNEFEMLCDKILNTS
ALDNILEEEEEDITPSKNTTQTNDVHNEDTIIRKEMHDFEINVNNHQPEFKRQPSDFSVN
GPDTSIFSIEPMPEGLGISKKPVRVQPTFNFIIDEDKVDDSIKVKQVSGTGPSNNVLKDI
SNQINNGKGIENSKLHPTSNNNYKNIRNVTAPEGNFTSKTFSLDPRRNVSQPPKESLFHS
LLNNKSSKNAEENTQFESKSKQYNFMNKTAHSEFEKERLNAHRDADRSNDQNVYNETSVL
AQSSTIHESPLLSIPSTLLNTSMTFKNLVDMLQENKLDDINETVAKESSAPLRKKSTKLS
LAPHSNLVSDLNKRTSGYNTLASVDRSSSDLSYAIDLPTNTNIAEIVYLSGNNKQSSEKN
IFMLSNDNNETELFHTDENKTSIKSAVNIFEDPPSDSTSLQTSSSESDSIPKVQRKAVSI
ETLNASNIITPAADVRVSLYGNNVSNSNTMPRETTEELISRFKLTPEKPQHQVQKRFSSL
TQTGRNTDSIALSQSMISMFKDAEENGNNKSVKVLDQVEEENASKLTPTSPKNRVTMLFD
DYEAQQNITSDQSNKSSKVIEIPNDSPIKVKVQKASTIFEKEIISAAEADENDHLRIPYE
SKSKKEIAQVHQQEQKEQQVRKPTESQEKAVQKTTKPSWFSKLIHGFKTTGGSGHTKLIR
EHSTKMTFEEVHMITVKEFGNNGIDYQLRTLDKKGDREKVEYDCKFVKGNFEFKIKIFNS
GFPHQNTIITVKKKGKINSKETTDLFQRFNANIENLIKSAERNIESNPK
NT seq 4470 nt   +upstreamnt  +downstreamnt
atgtcagttctaataccccatcaacagcagagactaagggcctcttctgcagctaagaaa
gctgcttggaacgctatgaataagacggtaaatatagtcagcccgcacaataatgtcaac
tacgtgaaaaagccatccccaaagaccaattctaaccatttggaccgtgtcatcaagtcg
gttaatgatgctacaaagaggctctcggaggcagaatctataaatagcaataatacaaaa
tcttccaaaaggaaatcaagagacaccgtgggtccatggaaacttgggaagaccctcggt
aagggctcctccgggagagttcgactagctaagaacatcgagaatggtaccttagccgcg
ataaaaatcgtgccaaagagaacgtataacaggcgtatgagggatcagaaaatgaaaacc
gctggtggcgtgtcgagtgggacagattccaaagattcatctaacagggaagatcctata
aagaatggcacggactcagctctgaacccatatggtattgagcgtgaaatagttataatg
aagctaatatcacacccaaatgtcatgggccttctcgaagtatgggaaaacaaatcagaa
ttatatttggtgttggagtacgtggatggtggtgagttattcgattacttagtttctaaa
ggaaagctctcggaacctgaagcagtacattattttacacaaatcatacaaggtgtctca
tattgccattctttcaatatctgtcacagagatctaaaaccagaaaatcttttattagat
aagaagaacaaagtaatcaagatagcagactttggtatggctgcgttggaactacccaat
aaattactagagacctcctgtggatcaccacactatgcatcgcctgaaattgtgatgggt
aaaccatatcatggtggtccaagcgacgtatggtcttgtggtatcattttgttcgcatta
ttgactggacatttacccttcaacgatgataatattaaaaagttactacttaaggttcaa
gccgggagatttcaactacctccatatttaactaatgatgccaaggatttaataacaaga
atattagtgactaaccctgaaaaacgactaacgattaatgaaattttaaatcatccatta
attaaaaaatacaggaatccacctgctcatattcgaaagctcaatcttttgggacgaggt
aaatcaaattcagatttgcatgtccttgaatataatacccccgccacagtgtgtttgaac
tcagaggaggatattgatcagtcgatcttgaaaagtctgcagattctatggcatggtact
ccaagacaacgtctagtagaaaggcttctagttgaaggagcaacagaggaaaagttgttc
tattcactcttgtttcagtataagttaaaacactcaaaaccaatatcagctacaaaactt
caaaagaaaatagaagatgttgtgcttgagaatgaatcaacaaaaactgaatctaaagat
agtagcaacgagccaggtattgacaacaacaatgatacttctgacttcacacaagatgga
aattcctctgaaatggtaaatgaattgcatacatcagctccaatgctggaacaaaagtca
cagtttagtcagcattctttgaagagtaaagagactgtgccaatttcggatctgccacca
ttaccgcctgtaattcctacattcgcggcctcatcttcgaaggctttcagaagaagtaaa
tcaaacctgtcttcgtatctgaaaaggccaaagttagaaaacgctagatcaagaacctcg
ttatttaattcttcttcgaatacatctattaccagttcatctatttcggagctaaatact
aggccaagaggaaatataccattatcgccaagtaatattactttaacttcattagtttct
tccagatcattgcataattctgcttcaaaaaaatctttgaagaatttacagaagagaact
cttcaaaattctgagtctaaaagatcactttattcgcagacttcaatctcaaagcgttcc
ttaaaccttaatgactatttgattggagggccttctaactccgcggaacttccacctcta
cctaagctcgattctaataacgaatttgaaatgttatgtgataaaatcttgaacactagt
gcattagataatattcttgaggaagaggaagaggatatcacgccttcaaagaatacaact
caaacaaatgatgtacataatgaagatactataattcgcaaagaaatgcatgattttgag
attaacgtcaataatcatcaaccagaatttaaacgccagccatcagatttctcagtgaat
ggaccagatacatctatttttagtatagaacccatgccagaaggacttggtattagtaaa
aagccagtacgtgtacaacccacctttaattttattattgatgaagataaagttgatgat
agcattaaggttaagcaagtttctggtacgggaccatctaataatgttctcaaagatata
agcaaccagattaataatggtaaaggaattgaaaactcaaaattgcatcctacttccaat
aacaactacaaaaatatcagaaatgttaccgctccagaaggtaactttacatcaaaaaca
ttttcgttagatccaaggaggaatgtttctcaacctccaaaagagtcgttgttccatagt
ctcttaaacaataaatcttccaaaaatgctgaagaaaatactcagtttgagtccaagtca
aagcaatacaactttatgaataaaactgcacattctgaatttgaaaaagaaaggctaaat
gctcacagagacgcggatagatcgaatgatcaaaatgtgtataatgaaaccagcgttctt
gcgcaatccagtacgattcatgagtctcctttgttatcaattccttcaactttattgaac
acatctatgaccttcaaaaatctggttgacatgctacaagaaaataaactagatgatatc
aacgaaactgtggctaaagagagcagtgcaccactgagaaaaaaatctacaaagttgtct
ttggctcctcattctaatttggtctctgatttgaacaaaaggacaagtggttacaacaca
ttagcaagtgttgatagatcttcttctgatctatcatatgccatagatctaccaacgaat
accaatattgcagaaattgtttatctatctggtaataacaagcaatcttctgagaagaat
atattcatgttatctaatgataacaatgaaacagagctttttcacactgatgaaaataaa
acttccataaaaagtgcagtcaatatattcgaagatcctccatcggattccacgtcattg
caaacatcctcttctgaatcggattctataccaaaagtacaaaggaaagccgtttctatt
gaaacgctaaatgcatctaatataattacaccagctgcagatgtgcgtgttagtttgtat
gggaataatgtgtccaattcaaatactatgccaagagagactactgaagagctgatctct
aggttcaagttgacgccggaaaagcctcaacatcaagtgcagaaaagattctcttcatta
actcaaacaggacggaataccgattcgattgcattatcacaaagcatgatttcaatgttt
aaggatgcagaggaaaacggaaacaacaaatctgtgaaggtattggaccaagttgaggaa
gaaaatgccagtaaattaacacctacaagtccaaaaaatagagtcacgatgctttttgat
gattatgaagcacaacagaatattacaagtgatcaaagcaataaaagttcaaaagttata
gagattccaaacgattccccaatcaaagtgaaggttcagaaggcctctaccattttcgag
aaggaaattatatctgctgctgaagcagatgagaacgaccatttaaggatcccttatgag
agcaaaagtaagaaggaaatagcacaggtgcatcaacaggaacaaaaagaacaacaagtg
agaaaacctaccgaatcgcaagagaaggctgtacaaaagactacgaaaccaagttggttc
tcaaagctaatacacggtttcaagacaacgggaggaagcgggcatacaaaactgattaga
gagcactctacaaaaatgacttttgaagaagtccatatgataacggtgaaagaatttgga
aataatggtatcgattatcaactccgtactttggataagaaaggagatcgtgagaaagtt
gaatatgattgtaaatttgttaaaggaaattttgaattcaagattaagatctttaattcc
ggtttccctcatcaaaacacaatcattacagtcaaaaagaaaggtaagattaattctaaa
gagacaacagatttgttccagaggtttaatgctaacattgagaatttgatcaagtctgca
gaaaggaacatagagtcaaacccgaaataa

DBGET integrated database retrieval system