KEGG   Candida glabrata: CAGL0L06842gHelp
Entry
CAGL0L06842g      CDS       T01024                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
cgr  Candida glabrata
Pathway
cgr00010  Glycolysis / Gluconeogenesis
cgr01100  Metabolic pathways
cgr01110  Biosynthesis of secondary metabolites
cgr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAGL0L06842g
Enzymes [BR:cgr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     CAGL0L06842g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C YjfB_motility Peptidase_S28
Motif
Other DBs
NCBI-GeneID: 2890819
NCBI-ProteinID: XP_449074
UniProt: Q6FL20
Position
L:771870..773786
Genome map
AA seq 638 aa AA seqDB search
MNYTEEYGLPSQISISEYLFHRLNQLKIWTIFGLPGDFNMPLLDKLYSIPTMRWAGNTNE
LNAAYAADGYSRLKHLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQL
LLHHTLGNGDYSVFYRIANDIACHTAIINDTDLCADEVDNCIRAAWGYQKPVYLGVPVNQ
VDIPVDSSRLNNPIDLSILKKTKETDAQVIDLLLKQMYSASKPIIVVDACVRRHDALKET
HALCELTNFPVFVTPMGKGTIDESYKNFGGVYSGSLSSPEVREVTDFADFVLFIGAILPE
FSTSTFHFGFKKKNCCILFPTSVKIKKATFPDMLLKGTLQSLVDTIEPSKITYKHQAKVD
IIAPKMEPSDSNLLRQEWVWNEISHWFKENDIIITETGSSAFGINQTRFPTNTIGINQAL
WGSVGFALCSCLGALFAVEEKTVVKHNLEIKLRNYNRNIFTENRTILFVGDGAFQLTVQE
LSTIIRWKLKPYIFIMNNNGYSVDRFLHHRSDASYYDVQPWNYLYLLELFGCTSFETRKI
VTVSDFKELLADESFAKPDKIRMIEIMLPQSDVPKTLIARWQAEKELSNKRAGDFSENSS
ENSSPTIDPHWVKKQYLGPVTPTSSLSTELHSRSQMYL
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgaattatactgaagaatatgggcttccaagtcagatttccatatcggagtatctattt
catagactgaatcagctaaaaatatggaccatattcggtctgcccggtgattttaatatg
cctctattggataagctgtattcgattcctacgatgagatgggcaggtaacaccaacgag
cttaacgcagcctatgctgcagatggttactcaaggctaaaacatctgggctgtctcata
actaccttcggtgttggtgagctctcagctatcaatggtgttgctgggtcatacgcagag
catgtgggaattctacacatagtagggatgcctccaacaagcgcacaaaccaagcaactc
ttgctacatcatacattgggtaacggagattactctgtattttaccgaatagcaaatgat
atagcctgtcacacagcaattatcaatgatactgacctgtgtgctgacgaagtcgacaat
tgtattagagcagcatggggctaccaaaagcctgtatatctaggagttcccgtaaaccaa
gtcgatattccagttgactcgagtagacttaataacccaatagatctaagcatattaaag
aagacaaaagaaacagacgcacaggtgatagatctcttattgaaacaaatgtatagcgca
tcaaaacctataatagtagtggatgcatgtgttaggcggcatgatgcattgaaagaaacg
catgcgttatgtgaactgactaactttcctgtgttcgtaactcctatgggtaaagggacc
attgatgaaagctataagaattttggtggtgtctattcaggatctttatcttctccagag
gttcgagaagtaacagactttgccgattttgtattatttattggtgctatattgccagaa
ttcagtacaagtacatttcattttggctttaagaaaaagaattgttgtatattattccca
acatctgtaaagataaagaaggctacttttcctgatatgcttcttaagggaactttacag
tcgttagttgacaccattgagccttccaagataacctacaagcatcaagccaaagtagat
attattgcaccaaagatggaaccctcagattccaatctgttaagacaagaatgggtctgg
aatgaaatatcacattggttcaaagaaaatgatattatcataacagagactggttcatca
gcgtttggtatcaaccaaacaagatttcccactaacactataggtattaaccaggcactt
tgggggtccgttgggtttgctttatgttcatgtttaggagctttatttgccgtggaagag
aaaacagtagtgaagcacaatcttgaaattaaacttcgcaattataatagaaatatcttt
actgaaaacaggactatattatttgttggtgatggtgcattccagctaacagtacaagaa
ttatcgacgataataaggtggaaactgaaaccttatatttttattatgaacaacaacggt
tactctgtagatagatttttgcatcatagatcggatgcatcttattatgatgtgcaacca
tggaactatttatacctgttagaattatttggctgtacatctttcgaaacccgtaagatt
gtaacagtaagtgattttaaagaactgctagccgatgaatccttcgccaagcctgataag
atacggatgatagagatcatgttacctcaaagcgatgttccaaagacactgattgccaga
tggcaagcagagaaggagctatcaaacaagagagctggtgacttcagtgaaaactcatca
gagaattcatcccctaccatagatccacactgggtcaaaaagcaatatttggggcctgtg
acaccaacaagcagcttgtcgactgaactgcattctaggagtcaaatgtatttatga

DBGET integrated database retrieval system