KEGG   Candida glabrata: CAGL0M13585gHelp
Entry
CAGL0M13585g      CDS       T01024                                 

Definition
(RefSeq) uncharacterized protein
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
cgr  Candida glabrata
Pathway
cgr00970  Aminoacyl-tRNA biosynthesis
cgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CAGL0M13585g
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cgr03029]
    CAGL0M13585g
Enzymes [BR:cgr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CAGL0M13585g
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CAGL0M13585g
Mitochondrial biogenesis [BR:cgr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CAGL0M13585g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 2891225
NCBI-ProteinID: XP_449934
UniProt: Q6FIL0
Position
M:complement(1337038..1338441)
Genome map
AA seq 467 aa AA seqDB search
MSISRLRALPELQKQYNIFTHIDVEGVKNSYKSLKDGILSGLLCGIKDNIVTKDMPTTCG
SEILRGYQSPYDATVVKLLKQEGSIVLGKTNLDEFGMGSRGIHSCFGPTFNPLYPAADKV
IMGGSSSGSAAAVVSEAVDFSLGTDTGGSVRLPATYGSIYGFKPSYGRISRYGVIAYAQS
LDTVGILTKNISTLRKVYHVLDKYDDKDPTSLENSYRDQILGIHERNTIKERKKYRIGIA
KEFSQDSIPETIMEALLAFVKKLLDLGHDVVPISIPSIKNALPIYYTLSPAEAVSNLSRF
DGIRYGYRDQESDMSDNVMFAPTRKQFGREVKNRILLGNYNLCSESFKNNYIRAQKLRVQ
LIDEMDSVFRYPNVLLNNKETTKSETNVDFLISLTTPSLPKKLEDFSVSDLDTPTKEYIN
DVFTMPMSLAGLPTLSIPIIPGQPIGVQLVGQYGFDEMVLDFAEMIQ
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatatctcgtcttcgtgctctcccggagctccagaagcagtataatatattcacc
catatagatgttgaaggggtcaagaacagttacaaaagtctgaaggatggcattcttagc
gggctactatgtggtataaaggacaacattgttactaaagatatgcctactacatgtggc
tcggagatactacgtggatatcaatcaccatacgatgcaacagttgtaaagctattaaag
caggaaggttcaattgttttagggaagacaaacttagatgaatttggtatgggttctcga
ggaattcactcctgttttggacccaccttcaatccattatatccagctgctgataaggtt
ataatgggaggatcatcatcaggttctgcagcagctgttgtttctgaagcagttgatttc
agtctagggactgataccgggggttcggtaaggctcccggctacttatggttcgatatat
ggattcaaaccatcatatggaagaatttcaaggtatggtgttattgcttatgcacagtct
ctggatactgttggtattttgactaaaaatataagcacgctaagaaaggtttatcatgta
cttgataagtacgatgataaggacccgacatcactagaaaactcataccgagatcagata
cttggaattcatgagagaaatactattaaagagagaaagaaatatcgcattggcatagca
aaagagttcagccaagatagcataccggagacaattatggaggccctattagcattcgtt
aagaaactcttagatttagggcatgatgtcgttccaatttctattccatcgatcaagaat
gccttgcctatttactatactctttcacctgcagaagctgtatcaaacctgtcacgtttt
gacggtattcgttacggttacagagatcaagaatcagatatgagtgataacgtgatgttt
gcgccaacaaggaagcaattcggtagagaagttaaaaatagaatattactaggaaattac
aacttatgttcagaatcatttaaaaataattacattagagcacagaaattacgggtacag
cttattgatgaaatggattctgtattcagatatccaaatgtgttactgaataacaaagaa
actacgaagtctgaaacaaatgttgactttttaattagcttgactactccaagtttacct
aaaaagttagaagattttagcgtaagcgatttagatacaccgacaaaggaatatattaat
gatgtattcacgatgccaatgtctctagcgggtctaccaacactttctattccaataatt
ccaggtcaaccaattggtgtgcaattagttggtcaatatggctttgatgaaatggtgttg
gactttgctgaaatgatccaatga

DBGET integrated database retrieval system