KEGG   Candida glabrata: CAGL0M13893gHelp
Entry
CAGL0M13893g      CDS       T01024                                 

Definition
(RefSeq) uncharacterized protein
  KO
K03252  translation initiation factor 3 subunit C
Organism
cgr  Candida glabrata
Pathway
cgr03013  RNA transport
Brite
KEGG Orthology (KO) [BR:cgr00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    CAGL0M13893g
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cgr03012]
    CAGL0M13893g
Translation factors [BR:cgr03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    CAGL0M13893g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: eIF-3c_N PCI Ribosomal_L27_C KIAA1430
Motif
Other DBs
NCBI-GeneID: 2891610
NCBI-ProteinID: XP_449948
UniProt: Q6FIJ6
Position
M:complement(1374814..1377246)
Genome map
AA seq 810 aa AA seqDB search
MSRFFATNYNYDETSSSSEEDLLSSSEELLSSSEEGELSDDSLFNDESESESDFDSDDSD
AKPYGPDWFKKPEFRKGGNKFLKGASYSDSDESDEEDGKKVVKSAREKLLDEMQAVYDKI
ETAEMSDDWMTILNEFDSITRLLVRAQQQNFGIPKIFVKVVAQVEDLVSNSEQTEIKNKA
VSKAFNTTKQRVKKIARENEALLAKFREDPQSFDKEDTVEPELPPLNEENKVFTGKGVNL
SSLASASSEFSFMASLQIVNDSRGKKNSNQAELIKTLEELLNIAKTPYERILAYLTLIPT
RLEESTNLSYQPIDQWKSTHDDLNKLFDILDENISSYQVTELAARNDDLETEPEPNANGI
REILGSLLSFTERLDDEFKKSLLNIDPHSSDYLERLRDEQNMYNLLLRTQLYMEATIPEE
RQEQLLARAFVRRLDHIYYKSNKLISIIENSAWKAVPSSYKSKYIPFSGNADEEYCSQLV
EGLSKSLANQDNVFLQKRATLSHIYYTALNGEFEVAKELLLKTKVQSNINKSDPSLQILF
NRVVVQLGLSAFKLCKIEECHQILNELLASSHLREILGQQSLQRIASNSSSSSSSEDREK
QCLPYHQHINLDLVDLVFMTSSLLIEIPQMTAYLTGIKTKKVPVYQKSVRRLVESFDKSF
FHGPPESIKEHVLYAAKSMQKGDWKGCLEYLKSVKTWNLLPNSVEVLDNLTERIQIETMK
TYVFTYRRFYEKISIKKFSELFSLPEDKIVTTMEKVIADLELNIKLDDNKTYIVIEKGDE
VSKLEEVAVKLNKEIRATRERLNPSHHNHR
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtttttttgccacaaactataactatgatgagaccagctcttcatctgaagaa
gacttgttgagttcttctgaggagttgctatcatcttctgaagaaggtgagttgtctgac
gactctctattcaacgatgaatctgaatctgaatccgattttgactcagatgattctgat
gcaaagccatacggtccagattggttcaagaagcctgaattcagaaagggaggcaacaaa
ttcctcaaaggtgccagctactctgactctgacgaatcagatgaggaagatggaaagaag
gttgtcaagtctgctagagagaagttgctagacgaaatgcaagccgtttatgacaagatt
gaaactgctgaaatgtctgatgactggatgaccattttgaatgaatttgactccattact
aggttgttggttagagctcagcaacaaaacttcggtattcctaagatttttgtcaaggtt
gttgcacaagttgaagatttggtttctaactcagaacaaaccgaaatcaaaaacaaagct
gtttcaaaggctttcaacaccaccaagcaaagagttaagaagattgcaagagagaatgaa
gctctactagctaaattcagagaagatcctcaatcgttcgataaagaagacacagtagaa
ccagaacttccacctctgaatgaggaaaacaaggtcttcactggtaaaggtgtcaatctt
tcttctttggctagtgcatcttctgaattcagtttcatggccagtttgcaaatcgtcaat
gacagcagaggtaagaagaactccaatcaagcagaactgataaagactttggaagaacta
ttaaacatcgcaaagaccccatatgagagaattctagcttacttgacgttgatcccaacc
agattggaggagtctactaacctgtcatatcaaccaatagaccaatggaagtctactcac
gacgacctgaacaagttgtttgacatcttagatgaaaacatctcttcttaccaagttacc
gaacttgccgccagaaatgacgacttggaaacagaaccagagccaaatgctaatggtatc
agagaaatcttgggttctctactatcattcaccgaaagattggatgatgaatttaagaaa
tccctattgaacatcgacccacattctagtgactacctagaacgtttgagagatgaacaa
aatatgtacaacttgcttctaagaactcaattgtacatggaagccactatcccagaagag
agacaagaacaactgcttgcccgtgcttttgtgagaagattggatcacatctactacaaa
tccaacaagctcatcagtattattgaaaacagtgcttggaaggctgtcccatctagctac
aaatctaaatacatcccattcagtggtaatgcagatgaagaatattgttctcagcttgta
gaaggtctgtccaaaagtctggccaatcaagataatgttttcctacaaaagcgtgccact
ttgagtcacatatactacactgcattgaatggcgaattcgaggtcgctaaggaattactt
ctaaagacaaaggtacaaagcaatattaacaagtctgacccatctctacaaattttattc
aacagagttgttgttcaattgggtctttctgcattcaaactatgtaagattgaggaatgt
caccaaatcctgaacgaacttctagcaagttcgcacttgagagaaatcttgggtcaacag
agtctgcagagaattgcctccaattcaagcagttcaagctcctctgaagaccgtgaaaag
caatgtctaccttatcaccagcacatcaaccttgaccttgttgacttggtcttcatgact
tcctctttattgatcgaaattcctcaaatgactgcatacttgactggtatcaagacaaag
aaggttcctgtttaccaaaagtctgtacgtcgtttagtagaaagtttcgacaagtcattc
tttcacggtcccccagaatctatcaaggaacatgttttatatgctgcaaagtccatgcaa
aaaggtgactggaagggttgtcttgaatacttaaagagtgtcaaaacctggaatttgctt
ccaaactctgttgaagttcttgacaatctaacggaaagaatccaaatcgaaaccatgaag
acttacgttttcacatacagaagattctacgagaagatatctattaagaagttttccgaa
ttattcagtctgcctgaagataaaattgttacaactatggaaaaagttattgctgatttg
gaactaaacatcaaacttgatgataataagacctacattgtcatcgagaagggtgacgaa
gtcagcaagctggaagaagtagctgtgaagctaaataaggagatcagagctaccagggag
cgtttgaacccatctcatcacaatcatcgttaa

DBGET integrated database retrieval system