KEGG   Campylobacter gracilis: CGRAC_1617Help
Entry
CGRAC_1617        CDS       T04020                                 

Gene name
hemN3
Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
cgra  Campylobacter gracilis
Pathway
cgra00860  Porphyrin and chlorophyll metabolism
cgra01100  Metabolic pathways
cgra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cgra00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CGRAC_1617 (hemN3)
Enzymes [BR:cgra01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     CGRAC_1617 (hemN3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C NIPSNAP
Motif
Other DBs
NCBI-ProteinID: AKT93040
Position
complement(1672861..1674225)
Genome map
AA seq 454 aa AA seqDB search
MNSIDFDAYAKFSRPGPRYTSYPTALEFSESFSYDGYLNELKNQKSSTPLSLYFHMPFCR
SACYFCGCNVIYTGKRDKMDRYLDYIEREMQILSGVVDGSRQVVQMHFGGGTPTYFSAEQ
LARHIKNIKKYFTNFSSEAEISCEIDPRFLNAEQLDVLVSNGFNRISYGVQDFDERVQKE
IHRIQPFELTRDVIAMARERGIKSINMDLIYGLPYQSLASFKRTLELALSLDPDRFAIFN
YAHVPWIKKSMRKFDETTLPEPKVKLEILKFTHDFLSANGYEMIGMDHYSKPADELHAAL
KNGSLHRNFQGYTTKGGADLIGIGLTSIGEGARHYAQNFKDMDAYEAAIDAGRLPYCRGV
LLNEEDLLRKEVIMGLMSNFCVDIEAIEEKFKIKFFEHFDVSLKQLEALKDFVQVSPHRI
SVTPTGTLLIRNIAMCFDEYMVKNLGEKRFSKTV
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
gtgaatagcatagacttcgacgcttacgcgaaattttcgcgcccggggcctcgctatact
agctatccgactgctttggaatttagcgaaagctttagctacgacgggtatttaaatgag
ctgaaaaatcagaaaagctccacgccgctgtcgctttactttcacatgccgttttgccgc
tccgcctgttatttttgcggctgcaacgtaatctacacgggcaagcgcgacaagatggat
cggtatttggactatatcgagcgcgaaatgcaaattttaagcggcgtcgtggacggctcg
cgccaggtcgtgcagatgcacttcggcggcggcacgcctacatattttagcgccgaacag
ctcgcgcgccacataaaaaatatcaaaaaatattttacaaattttagctctgaagccgaa
atcagctgcgagatcgatccgcggtttttaaacgccgagcagcttgacgtgctcgtttca
aacggctttaaccgcataagctacggcgtgcaggacttcgacgagcgcgtgcaaaaggag
atccatcgcatccagcctttcgagcttacgagggacgtcatagccatggcgcgagagagg
gggataaaatcgataaatatggatctgatctacggccttccgtatcagagcctagctagc
tttaagcgcacactggaacttgcgctttcgcttgatccggaccgctttgcgatatttaat
tacgcgcacgtgccgtggatcaaaaaatctatgcgtaaatttgacgagacgacactgcca
gaacccaaagtaaagcttgaaattttaaaatttacccatgattttttgagtgcaaacgga
tatgagatgattggcatggatcactactcaaagcccgcggacgagcttcatgccgcgctt
aaaaacggctcactacaccgcaatttccagggctatacgaccaagggcggcgccgatctg
atcggcatcgggctaactagcatcggcgaaggtgcgcgccactacgcgcaaaatttcaaa
gatatggacgcgtatgaagccgcgatagatgcaggcaggctgccgtattgcaggggcgtt
ttgctaaatgaagaggatctactgcgcaaagaggtgattatggggctgatgagtaatttt
tgcgtcgatatagaggcgatcgaggagaaatttaagataaaatttttcgagcactttgat
gtgagcttaaagcagcttgaggcgctaaaggatttcgtgcaagtctcgccgcatagaatt
tcggtaacgcctaccggcacgcttttgattcgcaatatcgcgatgtgttttgatgagtat
atggttaaaaatttgggcgagaagcgcttttctaaaaccgtttaa

DBGET integrated database retrieval system