KEGG   Cutibacterium granulosum: 4412665_00380
Entry
4412665_00380     CDS       T05425                                 

Definition
(GenBank) Uncharacterised protein
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
cgrn  Cutibacterium granulosum
Pathway
cgrn00472  D-Arginine and D-ornithine metabolism
cgrn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgrn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    4412665_00380
Enzymes [BR:cgrn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     4412665_00380
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A
Other DBs
NCBI-ProteinID: SNV30231
UniProt: A0A239W6U2
Position
1:437131..437550
AA seq 139 aa
MSTADEERVARFEDLRAELATLDDDALKARFWQLCEEVMTPVVDFSRTHTTPSIERSVLL
RMGIDSVTTHAVVENVLNAGLLGKGAGHAVLRLSRRDGIDLRAAAQRIADDPTVLDGLFD
GSPLPSARATALQGAHHEH
NT seq 420 nt   +upstreamnt  +downstreamnt
atgtccaccgccgatgaggagcgcgtggcccgcttcgaggaccttcgcgccgaactggcc
accttggatgacgacgccctcaaggcccgtttctggcagctgtgcgaagaagtcatgact
ccggtcgtcgacttctcccgcacccacaccaccccgtccatcgaacgttcggtactgctg
cgcatgggcattgactcggtgacgacccacgccgtcgtggagaacgtgctcaatgcggga
ctgctcggcaagggagccgggcatgccgtgctgcgcctttcccgtcgcgacggcatcgac
ctgcgcgcagccgcccagcggatcgccgacgatcccaccgtcctggatgggctcttcgac
ggcagcccgctgccgtcagctcgagccacagcactgcagggagcacatcatgagcactga

DBGET integrated database retrieval system