KEGG   Cutibacterium granulosum: 4412665_00447Help
Entry
4412665_00447     CDS       T05425                                 

Gene name
fhs
Definition
(GenBank) Formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
cgrn  Cutibacterium granulosum
Pathway
cgrn00670  One carbon pool by folate
cgrn01100  Metabolic pathways
cgrn01120  Microbial metabolism in diverse environments
cgrn01200  Carbon metabolism
Module
cgrn_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:cgrn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    4412665_00447 (fhs)
Enzymes [BR:cgrn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     4412665_00447 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS Amidohydro_1 CbiA AAA_31
Motif
Other DBs
NCBI-ProteinID: SNV30607
UniProt: A0A239W7W5
Position
1:526658..528349
Genome map
AA seq 563 aa AA seqDB search
MKSDLQIAREARLEPIEHVANRASIPESYLEHYGRDVAKVSLDIEQAHEGRPRAKYVVVT
AVTPTPLGEGKTTTAVGLAQGLEKIGRKTMLALRQPSMGPTFGIKGGAAGAGYSQVLPME
KLNLHLTGDFHAITAAHNLLAAMIDNHLHQGNALDIEPHSISWRRVVDVNDRALRNTIVG
LGSRIDGVPRQTGFDITAASEVGVILSLATSLADLRARLGRIVVAYTRSGEPVSAEDLHA
AGAMTVIMKDAIKPNLLQTTENTPVLVHAGPFGNIATGNSSVIADQVGSRCGDFLLTEAG
FGADMGAERFFNIKCRTSGLHPDAAVLVVTVRALKAHSGRYKVVAGKPLPPDMLADSPED
VLAGADNLRKHIEIVRTFGVSPIVALNVFPDDHDDEIDAVRRVAEQEGAHFAASTHVVDG
GNGAMELARAVVDACDQPTDFRYTYDLADSLETKIEKIATEVYGADGIDISPQAAKDLAH
FEELGYGRLPVVMAKTHLSLSHDPQLKGRPTGWRLPVREVRAAVGAGYVYAICGNMRTMP
GLGAHPAAERIDIDDNGQVVGLF
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcggatctgcagatcgcccgggaggctcgcctcgagcccattgagcacgttgcg
aaccgggcctcgatcccggagagctacctcgagcattacggccgcgacgtcgccaaggtg
tccctggacatcgagcaggcccacgagggacgcccccgtgccaagtacgtcgtcgtcacc
gccgtgacccccaccccactgggggagggcaagacgacgacggcagtcggactggcccag
ggactcgagaagatcggtcggaagacgatgctcgccctgcgtcaaccctcgatggggccg
accttcggcatcaagggcggcgctgccggggccggatactcccaggtgctccccatggag
aagctcaacctgcacctcacaggcgacttccacgccatcaccgccgcccacaacctcctg
gcggcaatgatcgacaatcacctgcaccagggcaacgccctcgacatcgaaccgcactcc
atctcgtggcgtcgcgtggtcgacgtcaacgaccgggccctgcgcaacaccatcgtcggt
ctgggatccaggatcgacggtgtgccccggcagaccggattcgacatcaccgcagccagc
gaggttggcgtcatcctgtccctggccacctcgctggccgacctacgagcccggctgggg
cgcatcgtcgtcgcctacacccgcagcggtgagccggtgagtgccgaggacctccatgcg
gcaggtgccatgaccgtcatcatgaaggacgccatcaaacccaatctgctgcagaccacc
gagaacaccccggtgctcgtccacgccggaccattcggcaacatcgccaccggaaactcc
tcggtcatcgccgaccaggtgggcagcaggtgcggtgacttcctgctcaccgaggccgga
ttcggtgccgacatgggagccgaacggttcttcaacatcaagtgccgcacctctggcctg
caccccgacgccgccgtcctggtggtgacggttcgcgccctcaaggcacactcgggacgc
tacaaggtcgtcgccgggaaaccactaccccccgacatgcttgccgacagccccgaagac
gtactcgccggtgccgacaacctgcgcaagcacatcgagatcgtccgcaccttcggagtg
tcgccgatcgtggcactcaacgtcttccccgacgaccatgacgacgagatcgatgcggtg
cgccgtgtcgccgagcaggaaggtgcccatttcgccgcctccacccacgtcgtcgatgga
ggcaacggagccatggagctggcccgcgccgtcgtcgacgcctgtgaccaacccaccgat
tttcggtacacctatgacctggccgacagtctggagaccaagatcgagaagattgccacc
gaggtctacggggccgacggcatcgacatctcgccgcaggccgccaaggacctcgcccac
ttcgaggagctgggctacggtcgacttcccgtcgtcatggccaagacccacctgtcgctg
tcccacgacccccagctcaagggtcgtcccaccggttggcgtctgccggtgcgtgaggtg
cgcgctgccgtgggcgccgggtacgtctacgcgatctgcggcaacatgcgcaccatgccc
ggactgggagcccatccggctgccgaacgcatcgacatcgacgacaacggtcaggtcgtc
ggcctcttctga

DBGET integrated database retrieval system