KEGG   Corynebacterium glutamicum SCgG1: C624_05375Help
Entry
C624_05375        CDS       T02690                                 

Definition
(GenBank) methionyl-tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cgs  Corynebacterium glutamicum SCgG1
Pathway
cgs00450  Selenocompound metabolism
cgs00970  Aminoacyl-tRNA biosynthesis
cgs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    C624_05375
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    C624_05375
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cgs01007]
    C624_05375
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cgs03016]
    C624_05375
Enzymes [BR:cgs01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     C624_05375
Amino acid related enzymes [BR:cgs01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   C624_05375
Transfer RNA biogenesis [BR:cgs03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    C624_05375
 Prokaryotic type
   Other AARSs
    C624_05375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f DZR
Motif
Other DBs
NCBI-ProteinID: AGN18660
Position
1148320..1150152
Genome map
AA seq 610 aa AA seqDB search
MTKNVLVSVAWPYANGPRHIGHVAGFGVPSDVFARFQRMSGNNVLMVSGTDEHGTPLLVQ
ADKEGVTVQDLADKYNRQIVEDLTGLGLSYDLFTRTTTSNHYAVVQELFRGLYDNGYMIK
ETTLGAISPSTGRTLPDRYIEGTCPICGTDGARGDQCDNCGNQLDPADLINPVSKINGET
PEFVETEHFLLDLPALAEALTEWLKGREDWRPNVLKFSLNLLDDIRPRAMSRDIDWGIPI
PVEGWQDNNAKKLYVWFDAVVGYLSASIEWAYRSGDPEAWRTFWNDPETKSYYFMGKDNI
TFHSQIWPAELLGYAGKGSRGGEIGDLGVLNLPTEVVSSEFLTMSGSKFSSSKGVVIYVK
DFLKEFGPDALRYFIAVAGPENNDTDFTWDEFVRRVNNELANGWGNLVNRTVSMAHKNFG
EVPVPGALEESDKKILDLATAAFESVAANLDQSKFKAGISEIMHVVGEANAYIAEQEPWK
LAKDDTKRERLATVLWTALQVVSDCNTMLTPYLPHTAQKVHETLGRDGIWAASPQIVEVT
NESPRQPIGVGLPDPEHTYPVIMGDYKTQLAKWQRIDVVPGTTLEKPAPLIAKLDPELGE
TGPEWAPVQN
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagaacgtgctcgtatctgttgcctggccgtatgccaacggaccccgtcacatt
ggacatgtggcggggtttggtgtcccctccgatgtgttcgcaaggttccagcgaatgtct
ggcaacaacgtgctcatggtgtccggcaccgatgagcacggcacgccacttctggttcaa
gcagacaaagaaggcgtcaccgttcaagacctcgcggataagtacaaccgccagatcgtc
gaagacctcaccggcctgggcctgtcctatgaccttttcacccgcaccaccacctccaac
cactacgcagtagtgcaggaactgttccgtggtctgtacgacaacggttacatgatcaag
gaaaccaccctcggtgcgatttccccatccactggccgtaccctgccagaccgctacatt
gaaggcacctgcccaatctgtggcaccgacggcgctcgtggcgaccagtgcgacaactgc
ggaaaccagctcgatccagcggacctgatcaacccggtatccaagatcaacggcgaaacc
ccagagttcgttgagaccgaacacttcctgctcgacctgccagcactagctgaagcacta
accgagtggctgaagggacgcgaagactggcgtccaaacgtgttgaagttctcgctcaac
ctgctggacgatatccgcccacgcgcaatgtcccgcgatatcgactggggcatcccaatc
ccagttgaaggatggcaagacaacaacgccaagaagctctacgtttggtttgacgctgtc
gttggctacttgtccgcatcaatcgaatgggcctaccgctccggcgacccagaagcatgg
cgcaccttctggaatgatccagaaaccaagtcctactacttcatgggcaaagacaacatc
accttccactcccagatctggccagctgaacttctcggctacgcaggtaagggctcccga
ggtggagagatcggcgacctgggtgttctgaacctgcctactgaggtcgtttcctctgag
ttcctgactatgtctggatccaagttctcctcatccaagggcgttgtcatctacgtgaag
gacttcctcaaggagttcggcccagatgcgctgcgatacttcatcgctgtcgcaggccca
gaaaacaacgacaccgacttcacctgggatgaatttgtccgccgcgtaaacaacgagctg
gcaaacggctggggcaacctggtcaaccgcactgtatccatggcgcacaagaacttcggt
gaagtaccagtacctggcgcactggaagaatctgacaagaagatccttgatcttgctacc
gctgcctttgaatccgttgctgcgaacctggatcagtccaagttcaaggccggtatctct
gaaatcatgcacgttgtcggtgaggccaacgcctacatcgcagagcaagaaccatggaag
cttgccaaggatgacaccaagcgcgagcgtcttgccaccgtgctgtggaccgcgctgcag
gttgtttctgactgcaacaccatgctgactccatacctgccacacactgcccaaaaggtt
catgaaaccttgggccgtgatggtatctgggcagcatcaccacagatcgtggaagtcacc
aacgaatcaccacgccagccaatcggtgtgggcctgccagatccagagcacacctaccca
gtaatcatgggcgattacaagacccagctggctaagtggcagcgcatcgacgttgtgcca
ggcaccaccttggagaagccagcaccgctgattgctaagctcgatccagaacttggtgaa
accggcccagaatgggcaccagtgcagaactaa

DBGET integrated database retrieval system