KEGG   Corynebacterium glutamicum SCgG1: C624_15100Help
Entry
C624_15100        CDS       T02690                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cgs  Corynebacterium glutamicum SCgG1
Pathway
cgs00071  Fatty acid degradation
cgs00072  Synthesis and degradation of ketone bodies
cgs00280  Valine, leucine and isoleucine degradation
cgs00310  Lysine degradation
cgs00362  Benzoate degradation
cgs00380  Tryptophan metabolism
cgs00620  Pyruvate metabolism
cgs00630  Glyoxylate and dicarboxylate metabolism
cgs00640  Propanoate metabolism
cgs00650  Butanoate metabolism
cgs00900  Terpenoid backbone biosynthesis
cgs01100  Metabolic pathways
cgs01110  Biosynthesis of secondary metabolites
cgs01120  Microbial metabolism in diverse environments
cgs01130  Biosynthesis of antibiotics
cgs01200  Carbon metabolism
cgs01212  Fatty acid metabolism
cgs02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cgs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C624_15100
   00630 Glyoxylate and dicarboxylate metabolism
    C624_15100
   00640 Propanoate metabolism
    C624_15100
   00650 Butanoate metabolism
    C624_15100
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C624_15100
   00072 Synthesis and degradation of ketone bodies
    C624_15100
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C624_15100
   00310 Lysine degradation
    C624_15100
   00380 Tryptophan metabolism
    C624_15100
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    C624_15100
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C624_15100
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    C624_15100
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cgs04147]
    C624_15100
Enzymes [BR:cgs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     C624_15100
Exosome [BR:cgs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   C624_15100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGN20583
Position
3317544..3318773
Genome map
AA seq 409 aa AA seqDB search
MSSVKDNDAVIVSIARSPIGRAKKGSLTTLRADDMAAQMVDAALKQVPELDTHDIYDLMM
GCGQPGGEAGFNIGRIVTEILGLDWIPATTVQRYCASSLQTSRMAFHAIKAGEGDAFISA
GVEAVSRFDRGTSDSWPNTKNPRFNSAAKVTQRIAASEQNWVDPRENGNLPDAYISMGQT
AENVAQYLRISREEQDEWAVLSQNRAEEAIKAGFFEREITPLTLPDGTVVAKDDGPRFGT
TIEKVQGLKSVFRENGTVTAANACPLNDGAAAAVIVSGAKAKSLGLKPLARIVSTGVSSL
SAEIMGLGPIKASQQALKHAGMSMEDIDLVEINEAFASQVIGCARELEIPVNKLNIHGGA
IALGHPFGMTGVRITATLLNGLQSTDQQFGLETMCTAGGQGMAMVLERL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgagctccgttaaagataacgatgccgtaattgtatccatagccaggtcaccaattggc
cgagcaaagaaagggtcattaactactcttcgagccgatgacatggcggctcaaatggta
gatgcggctctcaaacaggtacctgaactagatacccatgacatctatgacctgatgatg
ggctgtgggcaacccggcggcgaagcaggatttaacattgggcgcatagttacagaaatt
ctcggtctcgattggataccagcaactacagttcagcgttactgtgcatcttcactacag
accagcagaatggcatttcacgcaattaaggcaggcgagggagatgcgtttatttctgcc
ggtgtggaagccgtctctcgctttgaccgtggtacctcagattcttggccaaatactaag
aacccgaggtttaactcggctgccaaggtcacacaacgcattgcggcgagtgagcagaac
tgggtagacccacgtgaaaatggcaatctacctgatgcatatatttctatgggtcaaact
gctgaaaatgtggcgcagtatctgaggatcagccgtgaagaacaagatgaatgggccgtc
ctaagtcagaatcgtgcggaggaggccatcaaagcagggttctttgaacgtgaaatcaca
ccattgacattgcctgatggcaccgttgtggcaaaagatgatggaccgcgctttggaaca
accattgaaaaggtgcaaggactcaagtctgttttccgcgaaaatggcactgtaactgct
gcaaatgcttgtccgctcaatgacggtgcggctgctgccgtgattgttagtggagcaaaa
gccaagagcctgggtctgaaaccgctagcgagaatcgtctcaacaggcgtatctagtctt
tccgcagagatcatgggacttgggccaatcaaggcatctcaacaagcgctcaaacatgca
ggtatgtcaatggaagacatcgatctcgttgaaatcaatgaagcctttgcgtcacaagta
attggatgcgcacgagagctagaaatcccagtaaacaagctcaatattcatggaggagca
atcgcacttggccatccatttggaatgactggagtccgaattactgcgaccctactcaat
ggtctgcagtcgactgaccagcagtttggactagagacaatgtgtacagcaggaggacag
ggcatggccatggttctagaaagactctaa

DBGET integrated database retrieval system