KEGG   Corynebacterium glutamicum R: cgR_1214
Entry
cgR_1214          CDS       T00501                                 
Name
(GenBank) hypothetical protein
  KO
K06147  ATP-binding cassette, subfamily B, bacterial
Organism
cgt  Corynebacterium glutamicum R
Brite
KEGG Orthology (KO) [BR:cgt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cgt02000]
    cgR_1214
Transporters [BR:cgt02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    cgR_1214
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 AAA_22 AAA AAA_30 ABC_membrane_3 AAA_5 AAA_21 AAA_29 AAA_18 Mg_chelatase AAA_7 AAA_25 Rad17 bpMoxR RsgA_GTPase MMR_HSR1 DUF87 AAA_23
Other DBs
NCBI-ProteinID: BAF54192
UniProt: A4QD95
Position
complement(1318805..1322548)
AA seq 1247 aa
MKTEQSQKAQLAPKKAPEKPQRIRQLISVAWQRPWLTSFTVISALAATLFELTLPLLTGG
AIDIALGNAGDTLTTDLLDRFTPSGVSVLTSVIALIVLLALLRYASQFGRRYTAGKLSMG
VQHDVRLKTMRSLQNLDGPGQDSIRTGQVVSRSISDINMVQSLVAMLPMLIGNVVKLVLT
LVIMLAISPPLTIIAAVLVPLLLWAVAYSRKALFASTWSAQQKAADLTTHVEETVTGIRV
VKAFAQEDRETDKLDLTARELFAQRMRTARLTAKFIPMVEQLPQLALVVNIVGGGYLAMT
GHITVGTFVAFSSYLTSLSAVARSLSGMLMRVQLALSSVERIFEVIDLQPEHTDPAHPLS
LPDTPLGLSFNNVDFRGILNGFELGVQAGETVVLVGPPGSGKTMAVQLAGNFYQPDGGHI
AFDSNGHRTRFDDLTHSDIRKNLIAVFDEPFLYSSSIRENISMGLDVSDEQIEHAARLAQ
AHDFIDRLPNRYEEVIGERGLTLSGGQRQRIALARAFLAHPKVLVLDDATSAIDASTEDR
IFQALREELHDVTILIIAHRHSTLELGDRVGLVEDGRVTALGPLSEMRDHARFSHLMALD
FQDSHDPEFTLDNGSLPSQEQLWPEVSTEKQYKILAPAPGRGRGMSMPATPELLAQIEAL
PAATEETRVDAERLRTSTSGFKLLSLFKQVRWLIAAVVALLLVGVAADLAFPTLMRAAID
NGVQAQSASTLWWIAIAGSVVVLLSWAAAAINTIITARTGERLLYGLRLRSFVHLLRLSM
SYFERTMSGRIMTRMTTDIDNLSSFLQTGLAQTVVSVGTLIGVVTMLAITDAQLALVALS
VVPIIIVLTLIFRRISSRLYTASREQASQVNAVFHESIAGLRTAQMHRMEDQVFDNYAGE
AEEFRRLRVKSQTAIAIYFPGLGALSEIAQALVLGFGALQVMRGDISTGVLVAFVLYMGL
MFGPIQQLSQIFDSYQQAAVGFRRITELLATQPSVPDLGTNRHARQAATQPLLLDDVTFG
YSDDPILENVTVQIEPGTTVAVVGPTGAGKSTVVKLLSRLYDPNEGAVKAGEIDIKDFPT
ADWRRTIGTVPQEAHLFSGSIADNIGYGCREASTSKIEAAARRVGALNAIAAIPDGFNHQ
VGERGRNLSSGQRQLIALARAELIEPSIMLLDEATSTLDPATEAVILNASDRVTKGRTSI
IVAHRLATAKRADRILVVEQGRIIEDGSHDALLSANGTYARMWHLMA
NT seq 3744 nt   +upstreamnt  +downstreamnt
atgaaaactgagcaatctcaaaaagcacaattagcccctaagaaagcacctgaaaagcca
caacgcatccgccaacttatttccgtggcgtggcagcgaccttggctcacctcattcacc
gtaatcagcgctttagctgcaacgttgtttgaacttacacttccccttttgaccggcggc
gctatcgatattgcgctgggaaatgccggagatactttaaccactgacctgctggaccgt
ttcactccgagtggagtaagcgtgttgaccagcgtcattgccctcatcgtgcttctcgcg
ttgcttcgctatgccagtcaatttggacggcgatacaccgcaggcaagctcagcatgggg
gtacagcatgatgtccggcttaaaacgatgcgctcattgcagaacctcgatgggccaggt
caggactctattcgcacaggccaagtagtcagtcggtccatttcggatatcaacatggtg
caaagccttgtggcgatgttgccgatgttgatcggaaatgtggtcaagcttgtgctcact
ttggtgatcatgctggctatttccccgccgctgaccatcatcgctgccgtattggttccg
ctgctgttgtgggctgtggcctattcccgaaaggcgctttttgcgtccacgtggtcggcc
cagcaaaaggctgcggatctgaccactcatgtggaagaaactgtcacgggtatccgcgtg
gtcaaggcatttgcgcaggaagaccgcgagaccgataaattggatctcaccgcacgtgag
ttatttgcccagcgcatgcgcactgcacgtctgacggcaaagttcatccccatggttgag
cagcttccgcagcttgctttggtggtcaacattgttggcggtggctatttggccatgact
ggtcacatcacggtgggcacgtttgtggcgttttcttcctatctcactagcttgtcggcg
gtggctaggtccctgtcgggcatgctcatgcgcgtgcaattggcgctgtcttctgtggag
cgcatctttgaagtcattgatcttcagcctgaacacaccgatcctgcacaccccctgtca
cttcccgacactcccctgggtctgtcgttcaacaacgtagatttccgtgggattctcaac
ggttttgagctgggtgttcaggccggtgaaaccgttgtgttggtgggccctccaggttca
ggcaagaccatggctgtgcagcttgcgggaaacttttatcaaccagatggtggccacatc
gcctttgatagcaacggccatcgcactcgctttgacgacctcacccacagcgatatccgc
aagaatctcatcgcggtttttgatgagccgttcttgtactcctcctccatccgcgagaac
atctcgatgggtttggatgtcagtgatgagcagatcgaacacgcagccaggcttgcccag
gctcatgattttatcgatcggcttccaaacagatacgaggaagtcattggcgaacgcggc
ctgacgctttctggtggtcaacgccaacgcatcgccctcgcacgggctttcctggcgcat
cccaaagtgttggtgcttgatgatgccacctctgcgattgatgcctccactgaggaccgc
attttccaggccttgcgcgaagaactgcacgatgtcaccattttgatcatcgcgcaccgc
cactccactttggagctcggcgatcgggttggtctggtcgaagatggacgggtaacagca
ctgggaccgttgagtgagatgcgtgatcacgctcgtttctcgcatctgatggctcttgat
ttccaggattctcacgatccggaattcaccctcgacaacggttcactacccagccaagag
caattgtggccggaggtctccacagaaaagcagtacaagattcttgcacctgcccctggt
cgaggccgtggcatgtccatgccggcaacccctgagctgctcgcgcagattgaggcgctg
ccagcagcaacggaagaaacacgagttgatgccgagaggctgcggaccagtacctccggt
ttcaaattgctcagtttgttcaagcaggtccgttggctcatcgccgcagtcgtcgcgttg
ttgctggtaggcgttgcggccgatctagcatttccgacactgatgcgggcagccatcgac
aacggtgtgcaagcacaaagcgcctccacgttgtggtggatcgccatcgcaggcagcgta
gtagtcctcctatcctgggcagccgccgcgatcaacacgatcatcacggcacgcaccggt
gaacgactgctttacggcttgcgtctgcgctcatttgtgcatctattgcgcctgtccatg
agctatttcgaacgcaccatgtccggccgcatcatgacgcgcatgaccactgacatcgac
aacctctcgtccttcctccaaacaggtctggcgcaaacagttgtctctgtgggcacgctc
atcggtgtggtcaccatgctcgccatcaccgacgcacaactagcactcgttgcgctgtcc
gtggtgccgatcatcatcgtgctcactctcattttccgacgcatcagctccaggctgtac
accgcctcacgcgagcaagctagccaggtcaacgcggtgttccacgagtccatcgccggt
ttacgcaccgcgcagatgcaccgcatggaagaccaagtctttgacaattatgcgggcgaa
gcagaggaattccgacgcctgcgtgtgaaatcccagacggccatcgccatctacttcccc
ggccttggcgcgctctctgaaattgcccaggcactcgtgctcggtttcggtgcactgcag
gtaatgcgtggcgatatctccactggcgtactcgtggcattcgtgctgtacatgggcctg
atgttcggccccatccaacaactaagccaaatcttcgactcctaccaacaagccgccgtc
ggcttccgtcgcatcaccgaactgctcgcaacgcagcccagcgtcccagatctgggcacc
aacaggcacgctaggcaggctgccacgcagcctttattgcttgacgacgtcaccttcggc
tattcagacgatccgatcctagaaaacgtcaccgtgcagatcgagccaggaaccactgtc
gctgtggtgggccccaccggcgctggaaaatccaccgtggtgaaactcctttcccgtctc
tacgaccccaatgaaggtgccgtgaaagctggcgagatcgatatcaaggacttccccacc
gctgattggcgccgcacaatcggtaccgtgccacaagaagcacacttgtttagtggaagc
atcgccgacaacattggctacggatgcagggaggcgtcgacaagcaaaatcgaagcggca
gcacgccgcgtcggagccttaaacgccatcgccgccatccctgatggtttcaaccatcaa
gtcggtgaacgcgggcgcaacctgtcatccggacagcgccaactgatcgcgctggcgcgc
gccgaactcatcgagccttccatcatgcttctcgacgaagccacctccaccctcgacccc
gccaccgaagccgttatcctcaatgcctccgatcgagtcactaagggacgcaccagcatc
atcgtcgcgcaccgcttggcaaccgctaaaagggccgaccgtattcttgttgttgaacaa
ggacgtatcattgaggacggatctcacgacgcgttgttgtctgctaacggcacctacgcc
cgcatgtggcatttaatggcctga

DBGET integrated database retrieval system