KEGG   Corynebacterium glutamicum R: cgR_1655Help
Entry
cgR_1655          CDS       T00501                                 

Definition
(GenBank) hypothetical protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cgt  Corynebacterium glutamicum R
Pathway
cgt00230  Purine metabolism
cgt01100  Metabolic pathways
Module
cgt_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cgt00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    cgR_1655
Enzymes [BR:cgt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     cgR_1655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_16 MMR_HSR1 RsgA_GTPase AAA_22 AAA_29 AAA_25 CPT DUF1729
Motif
Other DBs
NCBI-ProteinID: BAF54647
UniProt: A4QEI1
Position
complement(1840569..1841141)
Genome map
AA seq 190 aa AA seqDB search
MSGDNQLGRLVILAGPSAVGKSTVVDRLRNDVPNLYFSVSMTTRAPRPGEVDGRDYFYVT
AQEFQDKIDCGEMLEWADIHGGLQRSGTPAGPVNEARQNGRPVLVEVDLAGARNIASLIP
DAETIFLAPPSWEVLVERLTGRGTESEDVIARRLETAREELAAQSEFKHVIINDDVDTAV
KAIEDVLLGA
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgggcgataaccaactaggacggctcgtaattcttgcgggcccctcagcggtcggt
aaatcgactgtggttgatcgcctccgcaatgacgttccaaacctgtatttcagtgtgtcg
atgaccactagggcacctcgtcctggtgaagtcgatggacgtgactatttctatgtcact
gcacaggaatttcaggacaaaatcgactgtggagagatgcttgaatgggcagatatccac
ggcggtttgcagcgttcaggcactccagcaggtcccgtcaatgaggctcgccaaaatggt
cggccagtattggttgaggttgatcttgcaggagcccgaaacatcgctagcttaattcca
gatgcagaaaccatcttccttgctccaccttcatgggaagttttggttgaacgcctcact
ggacgtggcaccgaaagcgaagacgttattgctcgcaggctcgagaccgcacgcgaagaa
ttggctgctcagagcgaatttaagcacgtcattatcaatgatgatgtggatacagccgtc
aaggctattgaggatgttctcctcggcgcttag

DBGET integrated database retrieval system