KEGG   Corynebacterium glutamicum R: cgR_1975Help
Entry
cgR_1975          CDS       T00501                                 

Definition
(GenBank) hypothetical protein
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cgt  Corynebacterium glutamicum R
Pathway
cgt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cgt01100  Metabolic pathways
cgt01110  Biosynthesis of secondary metabolites
cgt01130  Biosynthesis of antibiotics
cgt01230  Biosynthesis of amino acids
Module
cgt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cgt00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    cgR_1975
Enzymes [BR:cgt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     cgR_1975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE
Motif
Other DBs
NCBI-ProteinID: BAF54972
UniProt: A4QFF6
Position
complement(2174037..2174822)
Genome map
AA seq 261 aa AA seqDB search
MVATENRMLMEIAAEISTREATLGFQEVKTKSRSAGLTAAFDIASVFFSSGCNVVVAFDR
FASNWSDHSDHVDYAAQVAGFGASMLAYTVRRGQFDTAVRDIRDIKSEVDIPILLHDPII
DPYQIHEARVMGIDALQFPVWAMEQARLESLVDRTESLGMTAIVSVRNHEEAHRAVDAGA
TVVAIDITGYTGSLTLPEAFSGITQFMPKEVARIVLGGCSSPKELMRFARHSADAIFVPH
ADLATTKSLVTAGMHPACPSR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggttgcaacagagaaccgcatgttgatggaaatcgctgcggaaatatcgactcgggaa
gcaacgcttggttttcaagaagtcaaaactaaatctcgatcagcaggtctcacggcggct
ttcgatatcgcttcagtctttttttcgtctggatgtaatgtcgtagtcgcctttgatcgt
tttgcatccaattggtctgatcattcggatcatgtggactacgctgcacaggttgcgggt
tttggcgcatcaatgcttgcatatacggtgcgcaggggacagtttgataccgcagtacgc
gatatcagggacatcaaatctgaagtagacattcccattctgcttcatgatcccatcatc
gatccgtatcaaattcacgaagcccgcgtcatgggcatcgacgctcttcaattccccgta
tgggcgatggaacaagctcgactggaatctttggtggaccgcaccgaatcattgggcatg
acagccatcgtgtctgtgcgaaaccacgaagaagcgcatcgtgctgtggacgcaggagcg
acagtggtagcaattgatattactggttataccggctcactcactttgcctgaagcgttt
tcgggtatcacccaattcatgcccaaagaggtagcccgcattgtgctcggaggttgcagc
agccctaaagaactcatgcggtttgcacgacattctgcagacgccatctttgttccacat
gcagacctggccaccacaaaatctcttgtgacagcaggtatgcatccagcgtgcccatcg
cgttga

DBGET integrated database retrieval system