KEGG   Corynebacterium glutamicum R: cgR_2021Help
Entry
cgR_2021          CDS       T00501                                 

Definition
(GenBank) hypothetical protein
  KO
K03101  signal peptidase II [EC:3.4.23.36]
Organism
cgt  Corynebacterium glutamicum R
Pathway
cgt03060  Protein export
Brite
KEGG Orthology (KO) [BR:cgt00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    cgR_2021
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cgt01002]
    cgR_2021
Enzymes [BR:cgt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.36  signal peptidase II
     cgR_2021
Peptidases and inhibitors [BR:cgt01002]
 Aspartic peptidases
  Family A8: signal peptidase II family
   cgR_2021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_A8
Motif
Other DBs
NCBI-ProteinID: BAF55019
UniProt: A4QFK3
Position
complement(2224934..2225515)
Genome map
AA seq 193 aa AA seqDB search
MVNVTSKDAGANMTPMSKKEKRTTVKQVVALMAAIVVVIASLDQIVKQIMLSWLEPGVPV
PIIGDWFRFYLLFNPGAAFSMGGENSTWIFTTIQLSFVIGIAIYAPRIKHKWIAAGLALV
AGGALGNVLDRLFRDPSFFFGHVVDYISVGNFAVFNIADASISCGVVVFLIGMFLEDREN
AQHAKATDEKDEA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggtcaacgtgacctcaaaggatgcaggggcaaacatgacccccatgagtaagaaagaa
aagaggacaaccgttaaacaggtggttgccttgatggccgccatcgttgtggtgattgcg
tccctagaccaaatagtcaagcagattatgcttagttggttggaacctggcgttcccgtt
cccatcattggggattggttccgcttctacctcctgtttaaccccggagccgcattttcg
atgggtggggaaaacagcacctggatctttacaaccatccagttgagcttcgtcatcggt
atcgcaatctatgccccacgcatcaaacacaagtggatcgcggcaggacttgcccttgtt
gccggtggagccttgggaaacgtgttggaccggttgttcagagatccttccttcttcttc
ggacatgttgttgattacatctccgtaggaaactttgcagtatttaatatcgccgatgcc
tcgatttcttgcggcgtcgtggtgttcctgatcggaatgttccttgaggaccgtgaaaac
gcccagcatgccaaagcaactgacgagaaggatgaggcctga

DBGET integrated database retrieval system