KEGG   Corynebacterium glutamicum R: cgR_2099Help
Entry
cgR_2099          CDS       T00501                                 

Definition
(GenBank) hypothetical protein
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cgt  Corynebacterium glutamicum R
Pathway
cgt00260  Glycine, serine and threonine metabolism
cgt00750  Vitamin B6 metabolism
cgt01100  Metabolic pathways
cgt01110  Biosynthesis of secondary metabolites
cgt01120  Microbial metabolism in diverse environments
cgt01230  Biosynthesis of amino acids
Module
cgt_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cgt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    cgR_2099
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    cgR_2099
Enzymes [BR:cgt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     cgR_2099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: BAF55099
UniProt: A4QFT3
Position
complement(2316034..2317479)
Genome map
AA seq 481 aa AA seqDB search
MDYISTRDASRTPARFSDILLGGLAPDGGLYLPATYPQLDDAQLSKWREVLANEGYAALA
AEVISLFVDDIPVEDIKAITARAYTYPKFNSEDIVPVTELEDNIYLGHLSEGPTAAFKDM
AMQLLGELFEYELRRRNETINILGATSGDTGSSAEYAMRGREGIRVFMLTPAGRMTPFQQ
AQMFGLDDPNIFNIALDGVFDDCQDVVKAVSADAEFKKDNRIGAVNSINWARLMAQVVYY
VSSWIRTTTSNDQKVSFSVPTGNFGDICAGHIARQMGLPIDRLIVATNENDVLDEFFRTG
DYRVRSSADTHETSSPSMDISRASNFERFIFDLLGRDATRVNDLFGTQVRQGGFSLADDA
NFEKAAAEYGFASGRSTHADRVATIADVHSRLDVLIDPHTADGVHVARQWRDEVNTPIIV
LETALPVKFADTIVEAIGEAPQTPERFAAIMDAPFKVSDLPNDTDAVKQYIVDAIASTSV
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
gtggactacatttcgacgcgtgatgccagccgtacccctgcccgcttcagtgatattttg
ctgggcggtctagcaccagacggcggcctatacctgcctgcaacctaccctcaactagat
gatgcccagctgagtaaatggcgtgaggtattagccaacgaaggatacgcagctttggct
gctgaagttatctccctgtttgttgatgacatcccagtagaagacatcaaggcgatcacc
gcacgcgcctacacctacccgaagttcaacagcgaagacatcgttcctgtcaccgaactc
gaggacaacatttacctgggccacctttccgaaggcccaaccgctgcattcaaagacatg
gccatgcagctgctcggcgaacttttcgaatacgagcttcgccgccgcaacgaaaccatc
aacatcctaggcgctacctctggcgataccggctcctctgcggaatacgccatgcgcggc
cgcgagggaatccgcgtattcatgctgaccccagctggccgcatgaccccattccagcaa
gcacagatgtttggccttgacgatccaaacatcttcaacatcgccctcgacggcgttttc
gacgattgccaagacgtagtcaaggctgtctccgccgacgcggaatttaaaaaagacaac
cgcatcggtgccgtgaactccatcaactgggctcgcctcatggcacaggttgtgtactac
gtttcctcatggatccgcaccacaaccagcaatgaccaaaaggtcagcttctccgtacca
accggcaacttcggtgacatttgcgcaggccacatcgcccgccaaatgggacttcccatc
gatcgcctcatcgtggccaccaacgaaaacgatgtgctcgacgagttcttccgtaccggc
gactaccgagtccgcagctccgcagacacccacgagacctcctcaccttcgatggatatc
tcccgcgcctccaacttcgagcgtttcatcttcgacctgctcggccgcgacgccacccgc
gtcaacgatctatttggtacccaggttcgccaaggcggattctcactggctgatgacgcc
aactttgaaaaggctgcagcagaatacggtttcgcctccggacgatccacccatgctgac
cgtgtggcaaccatcgctgacgtgcattcccgcctcgacgtactaatcgatccccacacc
gccgacggcgttcacgtggcacgccagtggagggacgaggtcaacaccccaatcatcgtc
ctagaaactgcactcccagtgaaatttgccgacaccatcgtcgaagcaattggtgaagca
cctcaaactccagagcgtttcgccgcgatcatggatgctccattcaaggtttccgaccta
ccaaacgacaccgatgcagttaagcagtacatcgtcgatgcgattgcaagcacttccgtg
aagtaa

DBGET integrated database retrieval system