KEGG   Corynebacterium glutamicum R: cgR_2212Help
Entry
cgR_2212          CDS       T00501                                 

Definition
(GenBank) hypothetical protein
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
cgt  Corynebacterium glutamicum R
Pathway
cgt00630  Glyoxylate and dicarboxylate metabolism
cgt01100  Metabolic pathways
cgt01110  Biosynthesis of secondary metabolites
cgt01120  Microbial metabolism in diverse environments
cgt01200  Carbon metabolism
Module
cgt_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cgt00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    cgR_2212
Enzymes [BR:cgt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     cgR_2212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: BAF55216
UniProt: A4QG50
Position
2441878..2443176
Genome map
AA seq 432 aa AA seqDB search
MSNVGKPRTAQEIQQDWDTNPRWNGITRDYTADQVADLQGSVIEEHTLARRGSEILWDAV
TQEGDGYINALGALTGNQAVQQVRAGLKAVYLSGWQVAGDANLSGHTYPDQSLYPANSVP
SVVRRINNALLRSDEIARTEGDTSVDNWVVPIVADGEAGFGGALNVYELQKAMIAAGAAG
THWEDQLASEKKCGHLGGKVLIPTQQHIRTLNSARLAADVANTPTVVIARTDAEAATLIT
SDVDERDQPFITGERTAEGYYHVKNGLEPCIARAKSYAPYADMIWMETGTPDLELAKKFA
EGVRSEFPDQLLSYNCSPSFNWSAHLEADEIAKFQKELGAMGFKFQFITLAGFHSLNYGM
FDLAYGYAREGMTSFVDLQNREFKAAEERGFTAVKHQREVGAGYFDQIATTVDPNSSTTA
LKGSTEEGQFHN
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacgttggaaagccacgtaccgcacaggaaatccagcaggattgggataccaac
cctcgttggaacggcatcacccgcgactacaccgcagaccaggtagctgatctgcagggt
tccgtcatcgaggagcacactcttgctcgccgcggctcagagatcctctgggacgcagtc
acccaggaaggtgacggatacatcaacgcgcttggcgcactcaccggtaaccaggctgtt
cagcaggttcgtgcaggcctgaaggctgtctacctgtccggttggcaggttgcaggtgac
gctaacctctccggccacacctaccctgaccagtccctctacccagcgaactccgttcca
agcgtcgttcgtcgcatcaacaacgcgctgctgcgttccgatgaaatcgcacgcaccgaa
ggcgacacctccgttgacaactgggttgtcccaatcgtcgcggacggcgaagctggcttc
ggtggagcactcaacgtctacgaactccagaaggcaatgatcgcagctggcgctgcaggc
acccactgggaagaccagctcgcttccgagaagaagtgtggccacctcggcggcaaggtt
ctgatcccaacccagcagcacatccgcaccctgaactctgcccgccttgcagcagacgtt
gcaaacaccccaactgttgttatcgcacgtaccgacgctgaggcagcaaccctgatcacc
tctgacgttgatgagcgcgaccaaccattcatcaccggtgagcgcaccgcagaaggctac
taccacgtcaagaatggtctcgagccatgtatcgcacgtgcaaagtcctacgcaccatac
gcagatatgatctggatggagaccggcacccctgacctggagctcgctaagaagttcgct
gaaggcgttcgctctgagttcccagaccagctgctgtcctacaactgctccccatccttc
aactggtctgcacacctcgaggcagatgagatcgctaagttccagaaggaactcggcgca
atgggcttcaagttccagttcatcaccctcgcaggcttccactccctcaactacggcatg
ttcgacctggcttacggatacgctcgcgaaggcatgacctccttcgttgacctgcagaac
cgtgagttcaaggcagctgaagagcgtggcttcaccgctgttaagcaccagcgtgaggtt
ggcgcaggctacttcgaccagatcgcaaccaccgttgacccgaactcttctaccaccgct
ttgaagggttccactgaagaaggccagttccacaactag

DBGET integrated database retrieval system