KEGG   Corynebacterium glutamicum R: cgR_2274Help
Entry
cgR_2274          CDS       T00501                                 

Definition
(GenBank) hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cgt  Corynebacterium glutamicum R
Pathway
cgt00071  Fatty acid degradation
cgt00072  Synthesis and degradation of ketone bodies
cgt00280  Valine, leucine and isoleucine degradation
cgt00310  Lysine degradation
cgt00362  Benzoate degradation
cgt00380  Tryptophan metabolism
cgt00620  Pyruvate metabolism
cgt00630  Glyoxylate and dicarboxylate metabolism
cgt00640  Propanoate metabolism
cgt00650  Butanoate metabolism
cgt00900  Terpenoid backbone biosynthesis
cgt01100  Metabolic pathways
cgt01110  Biosynthesis of secondary metabolites
cgt01120  Microbial metabolism in diverse environments
cgt01130  Biosynthesis of antibiotics
cgt01200  Carbon metabolism
cgt01212  Fatty acid metabolism
cgt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cgt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    cgR_2274
   00630 Glyoxylate and dicarboxylate metabolism
    cgR_2274
   00640 Propanoate metabolism
    cgR_2274
   00650 Butanoate metabolism
    cgR_2274
  09103 Lipid metabolism
   00071 Fatty acid degradation
    cgR_2274
   00072 Synthesis and degradation of ketone bodies
    cgR_2274
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    cgR_2274
   00310 Lysine degradation
    cgR_2274
   00380 Tryptophan metabolism
    cgR_2274
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    cgR_2274
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    cgR_2274
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    cgR_2274
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cgt04147]
    cgR_2274
Enzymes [BR:cgt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     cgR_2274
Exosome [BR:cgt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   cgR_2274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: BAF55278
UniProt: A4QGB2
Position
2504448..2505674
Genome map
AA seq 408 aa AA seqDB search
MNPQDIVICSPLRTPVGAYGGSFTGVPVEDLATTVINAIVEATGITGDDVDDLILGQASP
NGAAPALGRVVALDSKLGQNVPGMQLDRRCGSGLQAIVTAAAHVASGAADLIIAGGAESM
SRVEYTVSGDIRWGVKGGDMQLRDRLAEARETAGGRNHPIPGGMIETAENLRREYGISRE
EQDKISAASQQRWGKAADAGLFDDEIVPVTVPAKKRGQEPTIVSRDEHGRPGTTVEKLAA
LRPIMGRQDAEATVTAGNASGQNDGAAAVIVTTRAKAEEKGLRPVMRLAGWSVAAVPPET
MGIGPVPATKKVLDRLGLTLEDIGAIELNEAFAAQALSVLKEWNISWEDERVNPLGSGIS
MGHPVGATGARMAVTLAHRMQRENTQYGLATMCIGGGQGLAAVFEKEN
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaccctcaagatattgtcatctgttccccattgcgcaccccagttggtgcttacggc
ggatccttcaccggcgtccctgttgaagatttggccaccaccgtgatcaacgcgatcgtt
gaggcaaccggcatcaccggcgacgatgtggacgatctgatcctcggccaggcatccccc
aacggtgcggctccagcactgggccgtgttgttgctctagattccaagcttggccaaaac
gttccaggcatgcagcttgatcgccgctgtggttccggcctgcaggcaattgtcaccgct
gctgcacacgttgcatccggtgctgctgatctgatcatcgcaggtggcgcggaatccatg
agccgcgttgagtacaccgtgtccggcgatatccgttggggtgtcaagggcggcgacatg
cagcttcgtgaccgccttgcagaagcacgcgaaaccgctggcggacgcaaccacccgatc
cctggtggcatgatcgagaccgctgagaacctgcgtcgcgaatacggcatctcccgcgag
gagcaggacaagatctccgcagcgtcccagcagcgttggggcaaggctgctgatgcgggg
cttttcgacgacgagatcgtgccagtcaccgtccctgccaagaagcgcggccaggagcca
accatcgtttctcgtgacgagcatggtcgaccaggaacaaccgtcgaaaagcttgccgct
ttgcgccccatcatgggccgccaggatgcggaagcaaccgtcaccgctggcaacgcgtcc
ggccaaaatgatggcgctgctgccgtcatcgtgaccactcgcgccaaggccgaggagaag
ggcctgcgcccagtcatgcgtttggctggctggtctgtggctgctgttcccccagagacc
atgggtattggacctgttcctgccaccaagaaggtcctggatcgtttgggccttaccctc
gaggacatcggcgcgatcgaactcaacgaagctttcgcagctcaggcactgtctgtgctg
aaggaatggaacatttcttgggaagatgagcgcgtcaacccactgggttccggtatttcc
atgggacacccagtcggtgccaccggtgctcgcatggcagtaaccttggctcaccgcatg
cagcgtgaaaacactcagtacggactggccaccatgtgcatcggtggcggccagggtctt
gcagctgtctttgaaaaggagaactaa

DBGET integrated database retrieval system