KEGG   Corynebacterium glutamicum R: cgR_2407Help
Entry
cgR_2407          CDS       T00501                                 

Definition
(GenBank) hypothetical protein
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
cgt  Corynebacterium glutamicum R
Pathway
cgt00072  Synthesis and degradation of ketone bodies
cgt00650  Butanoate metabolism
cgt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgt00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    cgR_2407
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    cgR_2407
Enzymes [BR:cgt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     cgR_2407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short NAD_binding_10 Epimerase THF_DHG_CYH_C Shikimate_DH F420_oxidored KR AlaDh_PNT_C TrkA_N 3HCDH_N Sacchrp_dh_NADP Glu_dehyd_C Pyr_redox Rossmann-like 2-Hacid_dh_C NAD_binding_2 NAD_binding_7 AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: BAF55415
UniProt: A4QGP9
Position
complement(2651641..2652402)
Genome map
AA seq 253 aa AA seqDB search
MSQSTNISLEGRTALITGGASGIGAACARAFSRAGATVTVCDRNEQAAKELAEEIGGDYW
AVDLSDTKALEFLTLDVDILVNNAGSQKVAPIHEFVPDDWRFIHKLMLESPFLLIRAALP
AMYERGFGRIINISSIHGLRASAFKSAYVAAKHGLESLSKVTALEGAEYGVTSNCMNPSY
VRTALVEKQIKDQAVTHGIAPEEVVEKIMLTESAIKGLVDADEVASLVTWLASDMAGMVT
GASYTVDGGWTAS
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagtccaccaacatttcacttgaaggtcgcacagctttgattactggaggtgca
tctgggattggggcggcttgtgctcgtgcgttctctcgggcaggtgccacagtgacggtg
tgtgatcggaatgagcaggcagcgaaagagttggctgaagaaattgggggagattactgg
gccgtggatctctcagataccaaggcgttggagtttctcaccttagatgtggatattttg
gtcaataacgccggtagtcaaaaagtcgcgccgattcatgagttcgttccggatgattgg
cgcttcattcacaagctgatgttggaatcccctttccttctaattcgtgccgcattgccc
gcgatgtatgagcgtggattcggacgcatcattaatatttcctccatccatgggcttcgt
gcgagtgcttttaaatcggcgtatgtggctgcaaagcatggcctggaaagcctttcgaaa
gttacggccctggagggtgcggaatatggggtgacatctaactgcatgaatccttcttat
gtgcggactgctttagtggagaaacagattaaagatcaggcagtcacacatggcattgct
ccagaagaagtggtggagaagatcatgcttacagaatctgcgataaagggacttgtcgat
gcggatgaggtcgcctctttggtcacgtggctggcatccgacatggcgggcatggttacc
ggcgcgtcttacaccgtggatggtggctggacagccagctag

DBGET integrated database retrieval system