KEGG   Corynebacterium glutamicum R: cgR_2413Help
Entry
cgR_2413          CDS       T00501                                 

Definition
(GenBank) hypothetical protein
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
cgt  Corynebacterium glutamicum R
Pathway
cgt00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:cgt00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    cgR_2413
Enzymes [BR:cgt01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     cgR_2413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: BAF55421
UniProt: A4QGQ5
Position
complement(2655688..2656308)
Genome map
AA seq 206 aa AA seqDB search
MKLLLASNNAKKLKELQRILDQAGLDSVELLALRDVEAYDEPIEDGRTFADNAQIKARAG
VAHTGIATIADDSGIAVEELNGMPGVLSARWSGAHGNDTANNELLLAQMEHVPDERRNAA
FVSVCVLALPDGQEFVQEGRWEGQLLRGPKGENGFGYDPLFIPAEEIGGQGRSSAELSAE
EKDALSHRGQALRGLVEKIAQVAAAS
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttcttcttgcatccaacaacgcaaagaaactcaaagaactccagcggattttg
gatcaagcaggcctagattccgttgaactgctcgcactgcgtgacgtcgaggcatacgac
gagccgatcgaagacggccgcacttttgccgacaacgcacagatcaaagcgcgcgccggg
gtagcccacacaggcatcgccacgatcgccgatgattcgggcatcgctgtcgaagaactc
aacggaatgcctggagttttgtccgcccgctggtccggcgcacacggcaacgacaccgcc
aacaacgaacttcttcttgcccagatggaacacgttcccgacgagcgtcgcaacgcagct
ttcgtttcggtgtgtgtgcttgcacttccagatggccaagaatttgttcaggaaggccgt
tgggaaggccaactcctacgcggacctaagggcgaaaacggtttcggatatgatccactg
ttcattccagcagaggaaatcggtggccagggacgcagctccgctgagctttccgcagag
gaaaaggatgctttgtcccaccgaggtcaagcgctgcgcggattggttgagaagatcgca
caggtagctgcggctagctaa

DBGET integrated database retrieval system