KEGG   Corynebacterium glutamicum K051: WA5_2080Help
Entry
WA5_2080          CDS       T02508                                 

Gene name
MurD
Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
cgu  Corynebacterium glutamicum K051
Pathway
cgu00471  D-Glutamine and D-glutamate metabolism
cgu00550  Peptidoglycan biosynthesis
cgu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    WA5_2080 (MurD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    WA5_2080 (MurD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cgu01011]
    WA5_2080 (MurD)
Enzymes [BR:cgu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     WA5_2080 (MurD)
Peptidoglycan biosynthesis and degradation proteins [BR:cgu01011]
 Precursor biosynthesis
  Amino acid ligase
   WA5_2080 (MurD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C AlaDh_PNT_C Methyltransf_16 2-Hacid_dh_C Pyr_redox TrkA_N XdhC_C Shikimate_DH NAD_binding_8 DUF1188 NAD_binding_7 Methyltransf_24 NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: CCH25300
Position
complement(2285434..2286852)
Genome map
AA seq 472 aa AA seqDB search
MVSLSHLPQALQGRILVAGAGVSGLSIAKMLSELHCDVVVADDNETARHMLIEVVDVADI
STAQAQEQLDSFSIVVTSPGWRPTSTLLVDAHRQGLEVIGDVELAWRLDQAGVFGEPHTW
LAVTGTNGKTTTTSMLAAMMNEGGFTAKAVGNIGIPVSEALVAKNRIDVLVAELSSFQLH
WSPTFTPDAGVVLNLAEDHIDWHGSMRDYALAKMEVLKGKVAIIGADDPYLVQLTSEADL
SGLIGFTVNEPATGQLGVKAGELVDNAYGNNVVLASADGINPAGPAGVLDALAAAAVARS
QGVAPEAIARALDSFEVAGHRGQVVAEHDGVHFIDNSKATNPHAADSALAGHDSVIWVVG
GQLKGADIAPLVKKHEQRIKAALVLGADRAEIVAALKEHASQASVFVTDKTEPFEAMEEI
VTEAFSISEPGDTVLLAPAAASLDMFKGMGQRGDLFAHNIIGTIKGLTEEKG
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggtttctctgtcccatttacctcaggcgctgcagggccgtattcttgtggccggcgct
ggtgtttccggcctgtccattgcaaagatgctcagtgagttgcattgcgatgttgtggtc
gccgacgataacgaaactgcacgtcacatgctcattgaagtagtagacgttgcagatatc
agcaccgcgcaggctcaggaacagctggattctttctccattgtggtcacctccccgggc
tggcgcccaacaagcactttgcttgtcgacgcccaccgccagggccttgaggttatcggt
gacgtcgagcttgcttggcgcctggaccaggcaggtgttttcggcgagccacatacgtgg
ctcgcagtcaccggcaccaacggtaaaaccaccaccacatcaatgctcgccgcgatgatg
aatgagggcggttttactgccaaggcagtgggcaatatcggcatcccggtgtctgaggct
ttggtagcgaaaaaccgcattgatgtgttagttgcagagctgtctagtttccaattgcac
tggtctccaaccttcacccctgatgctggcgtggtgctcaacttggctgaggatcacatc
gattggcacggttccatgcgtgattatgcgttggccaagatggaagtgctcaagggcaag
gtcgccatcattggggcagacgatccttatttggtgcagctgacttctgaagcagacttg
agtggtctcattggatttaccgtcaatgagcctgcaaccggccagttgggtgtgaaagcg
ggggagctcgtcgataatgcctacggcaataatgtggtgcttgcatccgctgacggcatt
aatcccgccggccctgccggtgttttggacgctttggctgcagctgcggtggcgcgctcg
cagggcgtggcacctgaggcgatcgcgcgtgcgttggattcttttgaggtggcaggccac
cgtggccaggtcgtcgccgagcatgacggtgttcatttcattgacaactccaaggcgacc
aacccccacgctgctgattctgcgctagctgggcatgattcagtcatttgggttgtcggc
ggacagctcaaaggcgcggacattgcgccactggtgaaaaagcacgaacagcgcatcaag
gcagcattggtgttgggcgcagatcgtgctgaaatcgtggcagcgttgaaggaacacgcg
tcgcaggcctctgtatttgtcactgacaagacggagccatttgaggcaatggaagaaatc
gtcactgaggcatttagcatcagcgaacccggcgataccgtgttgcttgcccctgccgct
gcgtctttggacatgttcaaaggcatgggccagcgtggcgacctctttgcacacaacatc
attggcacaatcaaaggattaacggaagagaaaggctga

DBGET integrated database retrieval system